KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0682Help
Entry
Psyr_0682         CDS       T00246                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psyr_0682
Enzymes [BR:psb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Psyr_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
784699..786792
Genome map
AA seq 697 aa AA seqDB search
MSRSFDDLLPTALDDISLAELSPLTRVSDLLILLERWVERGWLRALDKAFVAFLSDLDPQ
ADPLVLVAAALTSHQLGHGHVCLDLYETLKEPDFALSLPPEGDQQSAPMLLPSQLLAALD
GAAWCQALAASMLVAEVGDLSAEARQKPLVLAERRLYLRRYWTYERRIAAALRQRLAQRE
TPPEGLPQRLDALFGPADSSPQAVIDWQKLACALATRKGFSIITGGPGTGKTTTVVRLLA
LLQAPAVQSGQPLRIRLAAPTGKAAARLTESISQQVQSLDVSDDVRQKIPSEVTTVHRLL
GSRPGTRHFRHHAGNLLPLDVLVVDEASMIDLEMMANLLYALPAHARMVLLGDKDQLASV
EAGAVLGDLCRDAEEGFYSPDTQAWLEAVSGEDLGKGGLRQGDAQQHPLAQQVVMLRHSR
RFGQGSGIGQLARLVNQQQDQQARALLSAGSHDDLFALALKGEQDLKFERLVLDGLGRGE
QGPQGYRHYLNVLAAERPADDSALDDACWTRWARSVLSAFDAFQLLCAVRKGPWGVEGLN
QRITHALFSAKLIESEQQWYEGRPVLMTHNDYGLGLMNGDIGITLRLPERDGEGKQVLRV
AFPRNDGSEGVRFVLPSRLNEVETVYAMTVHKSQGSEFAHTALILPEALNPVLTKELIYT
GITRAKHWFSLIEPRQGIFEEALRRKVKRLSGLMLGL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctcgttcgatgatctgttgcctaccgcgctggacgacatcagcctcgctgag
ttgagcccgctgacgcgtgtcagcgatctgctgatcctgctcgaacgttgggtcgagcgc
ggctggttgcgtgctctggacaaggcgttcgtcgcgttcctcagtgacctcgatccgcag
gccgatccgttggtgctggtggctgcggcgcttaccagccatcagctcggccacggtcac
gtctgccttgatctgtacgagaccctcaaagaaccggacttcgccctgtcactgccacct
gaaggcgatcagcagagcgcgccgatgctgctcccctcacaactgttggcagcgttggat
ggtgccgcttggtgccaggcgctggcagccagcatgctggtcgccgaggtgggcgattta
agtgccgaagcgcgacaaaagccattggtgctggccgagcggcgtctgtacctgcgtcgc
tactggacttacgaacggcgtattgctgccgccttgcgtcagcgcctggcccagcgtgaa
acaccgccggagggtctgccgcagcggctcgacgcattgttcggcccggccgattcttcg
ccacaagccgtcatcgactggcagaaacttgcctgcgcactggcgacccgcaagggcttc
agcatcatcaccggcggccccggcaccggcaaaaccaccacggtggtgcgcctgctggct
ttgttgcaggcaccggcggtacagagtggccagccgctgcgcatccgtctcgcggcaccc
accggcaaggcggcggcacgtctgaccgagtccatcagccaacaggtgcagagcctggac
gtcagtgacgacgtacgccagaaaatccccagcgaggtgaccaccgtccaccgcctgctg
ggcagtcgccccggtacccggcacttccgccaccatgcgggtaatttactgccgctggat
gtgctggtggttgatgaagcctccatgatcgacctggaaatgatggctaacctgctctac
gcactgcctgcgcatgcacgcatggttctgctgggtgacaaggaccagctggcatccgtt
gaggcgggggcggtactcggggatttgtgccgcgacgccgaagaaggtttctacagcccc
gacacccaggcctggctggaagccgtcagcggcgaagacctcggcaagggcggtttgcgc
cagggcgatgcgcagcagcatccgttggcccagcaagtggtgatgctgcgccactcacgt
cgtttcggccaaggcagcggtatcggccagttggcccggctggtcaaccagcaacaggac
caacaggcccgcgcgctgctgtcggcgggcagtcatgacgacctgttcgccttggctctc
aagggcgagcaggacctcaagttcgaacgcctggtgctcgacggtcttggcaggggcgag
caaggtccgcagggttaccggcattacctgaacgtactcgccgccgagcgtcccgccgat
gattcggcactggacgacgcgtgctggacccgctgggcgcgctcggtactcagcgccttc
gatgcctttcaactgctgtgtgccgtgcgcaaaggcccgtggggcgtggaaggcttgaac
cagcgcatcacgcacgcgctgttcagcgcgaagctgatcgaaagcgaacagcaatggtac
gaaggtcgcccggtgctgatgacccacaacgactacggcctcggcctgatgaacggcgac
atcggcatcactttgcgcctgcccgagcgcgacggcgagggcaaacaggtgttgcgcgtc
gccttcccccgcaacgacggcagcgaaggcgtacgcttcgtcctgcccagccgcctcaac
gaggtcgaaaccgtgtacgccatgaccgtacacaaatcccagggctcggaattcgcccac
accgccctgatcctgcccgaagcgctcaacccggtactgaccaaggagctcatctacacc
ggcatcacccgcgccaagcactggttcagcctcatcgaaccgcgccagggcatcttcgaa
gaagccctgcgccgcaaggtcaaacgcctgagtgggttgatgctggggctttga

DBGET integrated database retrieval system