KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0682Help
Entry
Psyr_0682         CDS       T00246                                 

Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psyr_0682
Enzymes [BR:psb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Psyr_0682
DNA repair and recombination proteins [BR:psb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Psyr_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 AAA_22 Viral_helicase1 PhoH DUF2075 UvrD-helicase AAA_16 T2SSE NACHT AAA_28 NTPase_1 AAA_17 AAA_29 AAA_5 UvrD_C
Motif
Other DBs
NCBI-GeneID: 3366165
NCBI-ProteinID: YP_233790
UniProt: Q4ZYM0
Position
784699..786792
Genome map
AA seq 697 aa AA seqDB search
MSRSFDDLLPTALDDISLAELSPLTRVSDLLILLERWVERGWLRALDKAFVAFLSDLDPQ
ADPLVLVAAALTSHQLGHGHVCLDLYETLKEPDFALSLPPEGDQQSAPMLLPSQLLAALD
GAAWCQALAASMLVAEVGDLSAEARQKPLVLAERRLYLRRYWTYERRIAAALRQRLAQRE
TPPEGLPQRLDALFGPADSSPQAVIDWQKLACALATRKGFSIITGGPGTGKTTTVVRLLA
LLQAPAVQSGQPLRIRLAAPTGKAAARLTESISQQVQSLDVSDDVRQKIPSEVTTVHRLL
GSRPGTRHFRHHAGNLLPLDVLVVDEASMIDLEMMANLLYALPAHARMVLLGDKDQLASV
EAGAVLGDLCRDAEEGFYSPDTQAWLEAVSGEDLGKGGLRQGDAQQHPLAQQVVMLRHSR
RFGQGSGIGQLARLVNQQQDQQARALLSAGSHDDLFALALKGEQDLKFERLVLDGLGRGE
QGPQGYRHYLNVLAAERPADDSALDDACWTRWARSVLSAFDAFQLLCAVRKGPWGVEGLN
QRITHALFSAKLIESEQQWYEGRPVLMTHNDYGLGLMNGDIGITLRLPERDGEGKQVLRV
AFPRNDGSEGVRFVLPSRLNEVETVYAMTVHKSQGSEFAHTALILPEALNPVLTKELIYT
GITRAKHWFSLIEPRQGIFEEALRRKVKRLSGLMLGL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctcgttcgatgatctgttgcctaccgcgctggacgacatcagcctcgctgag
ttgagcccgctgacgcgtgtcagcgatctgctgatcctgctcgaacgttgggtcgagcgc
ggctggttgcgtgctctggacaaggcgttcgtcgcgttcctcagtgacctcgatccgcag
gccgatccgttggtgctggtggctgcggcgcttaccagccatcagctcggccacggtcac
gtctgccttgatctgtacgagaccctcaaagaaccggacttcgccctgtcactgccacct
gaaggcgatcagcagagcgcgccgatgctgctcccctcacaactgttggcagcgttggat
ggtgccgcttggtgccaggcgctggcagccagcatgctggtcgccgaggtgggcgattta
agtgccgaagcgcgacaaaagccattggtgctggccgagcggcgtctgtacctgcgtcgc
tactggacttacgaacggcgtattgctgccgccttgcgtcagcgcctggcccagcgtgaa
acaccgccggagggtctgccgcagcggctcgacgcattgttcggcccggccgattcttcg
ccacaagccgtcatcgactggcagaaacttgcctgcgcactggcgacccgcaagggcttc
agcatcatcaccggcggccccggcaccggcaaaaccaccacggtggtgcgcctgctggct
ttgttgcaggcaccggcggtacagagtggccagccgctgcgcatccgtctcgcggcaccc
accggcaaggcggcggcacgtctgaccgagtccatcagccaacaggtgcagagcctggac
gtcagtgacgacgtacgccagaaaatccccagcgaggtgaccaccgtccaccgcctgctg
ggcagtcgccccggtacccggcacttccgccaccatgcgggtaatttactgccgctggat
gtgctggtggttgatgaagcctccatgatcgacctggaaatgatggctaacctgctctac
gcactgcctgcgcatgcacgcatggttctgctgggtgacaaggaccagctggcatccgtt
gaggcgggggcggtactcggggatttgtgccgcgacgccgaagaaggtttctacagcccc
gacacccaggcctggctggaagccgtcagcggcgaagacctcggcaagggcggtttgcgc
cagggcgatgcgcagcagcatccgttggcccagcaagtggtgatgctgcgccactcacgt
cgtttcggccaaggcagcggtatcggccagttggcccggctggtcaaccagcaacaggac
caacaggcccgcgcgctgctgtcggcgggcagtcatgacgacctgttcgccttggctctc
aagggcgagcaggacctcaagttcgaacgcctggtgctcgacggtcttggcaggggcgag
caaggtccgcagggttaccggcattacctgaacgtactcgccgccgagcgtcccgccgat
gattcggcactggacgacgcgtgctggacccgctgggcgcgctcggtactcagcgccttc
gatgcctttcaactgctgtgtgccgtgcgcaaaggcccgtggggcgtggaaggcttgaac
cagcgcatcacgcacgcgctgttcagcgcgaagctgatcgaaagcgaacagcaatggtac
gaaggtcgcccggtgctgatgacccacaacgactacggcctcggcctgatgaacggcgac
atcggcatcactttgcgcctgcccgagcgcgacggcgagggcaaacaggtgttgcgcgtc
gccttcccccgcaacgacggcagcgaaggcgtacgcttcgtcctgcccagccgcctcaac
gaggtcgaaaccgtgtacgccatgaccgtacacaaatcccagggctcggaattcgcccac
accgccctgatcctgcccgaagcgctcaacccggtactgaccaaggagctcatctacacc
ggcatcacccgcgccaagcactggttcagcctcatcgaaccgcgccagggcatcttcgaa
gaagccctgcgccgcaaggtcaaacgcctgagtgggttgatgctggggctttga

DBGET integrated database retrieval system