KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0704Help
Entry
Psyr_0704         CDS       T00246                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psyr_0704
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Psyr_0704
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Psyr_0704
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Psyr_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806935..808053
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAQRWVVKIGSALLTADGKGLDRNAMGVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTARPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGG
RIERVLARLKGGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDDGAVAALARDQKSL
LPVGVKLVQGSFRRGEMVVCVAQDGREIARGLSNYSAIEAQKIIGHSSESIVRELGYMAE
PELIHRDNLILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaaagtgacgggcgcccagcgctgggttgtgaagattggcagtgccttgctg
acggcggatggcaagggtctggatcgcaacgccatgggtgtttgggtggagcagatggtg
gcgctgcacgaggcgggtgtcgagctggtactggtgtcttccggggcggtggctgccggc
atgagccgtcttggctggacggcccgacccagcgccatgcatgagctccaggctgctgcg
gcgattggtcagatgggcttggtgcaggcgtgggagtcgagcttcgccgagcatggccga
cataccgcgcagatccttctgactcacgatgacctgtcggaccgcaagcgctacctgaat
gcccgtagcaccctgcgcacgctggtcgagcttggggttgtgccggtcatcaatgaaaac
gacacagtggtcaccgacgaaatccgttttggcgataacgacacgctggcggcgttggtt
gccaatctggtcgaggctgatctgctggtcatcctgaccgaccgtgacggcatgttcgac
gctgatccgcgcaacaacccggaggcgcagctgatttacgaagcgcgtgccgatgatccg
gcgctggatgcagtggccggtggtaccggcggtgcgctgggtcgcggcggcatgcagacc
aagttgcgtgcagcgcgactggcggcgcgttccggtgcgcataccgtcatcgtcggcggg
cgcatcgagcgcgttctggcgcggctcaagggaggggagcggttgggtacgctgctgtcc
ccggagcgcggcatgctcgcagcacgcaagcagtggctggcaggtcatctgcagacccgc
ggtacgctggtgctggatgatggcgctgttgcggcgctggccagggatcagaaaagcctg
ctgccggtgggcgtcaaactggtccagggcagcttccggcgcggcgagatggtggtatgc
gtcgcccaggacggtcgcgagatcgctcgtgggctgagtaactacagtgccatcgaagcc
cagaaaatcattggtcactcttccgaatccatcgtgcgcgagctgggctatatggccgag
cccgagctgattcatcgggataacctgatcctcgtctga

DBGET integrated database retrieval system