KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0704Help
Entry
Psyr_0704         CDS       T00246                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psyr_0704
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Psyr_0704
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Psyr_0704
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Psyr_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806935..808053
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAQRWVVKIGSALLTADGKGLDRNAMGVWVEQMVALHEAGVELVLVSSGAVAAG
MSRLGWTARPSAMHELQAAAAIGQMGLVQAWESSFAEHGRHTAQILLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPALDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTVIVGG
RIERVLARLKGGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDDGAVAALARDQKSL
LPVGVKLVQGSFRRGEMVVCVAQDGREIARGLSNYSAIEAQKIIGHSSESIVRELGYMAE
PELIHRDNLILV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaaagtgacgggcgcccagcgctgggttgtgaagattggcagtgccttgctg
acggcggatggcaagggtctggatcgcaacgccatgggtgtttgggtggagcagatggtg
gcgctgcacgaggcgggtgtcgagctggtactggtgtcttccggggcggtggctgccggc
atgagccgtcttggctggacggcccgacccagcgccatgcatgagctccaggctgctgcg
gcgattggtcagatgggcttggtgcaggcgtgggagtcgagcttcgccgagcatggccga
cataccgcgcagatccttctgactcacgatgacctgtcggaccgcaagcgctacctgaat
gcccgtagcaccctgcgcacgctggtcgagcttggggttgtgccggtcatcaatgaaaac
gacacagtggtcaccgacgaaatccgttttggcgataacgacacgctggcggcgttggtt
gccaatctggtcgaggctgatctgctggtcatcctgaccgaccgtgacggcatgttcgac
gctgatccgcgcaacaacccggaggcgcagctgatttacgaagcgcgtgccgatgatccg
gcgctggatgcagtggccggtggtaccggcggtgcgctgggtcgcggcggcatgcagacc
aagttgcgtgcagcgcgactggcggcgcgttccggtgcgcataccgtcatcgtcggcggg
cgcatcgagcgcgttctggcgcggctcaagggaggggagcggttgggtacgctgctgtcc
ccggagcgcggcatgctcgcagcacgcaagcagtggctggcaggtcatctgcagacccgc
ggtacgctggtgctggatgatggcgctgttgcggcgctggccagggatcagaaaagcctg
ctgccggtgggcgtcaaactggtccagggcagcttccggcgcggcgagatggtggtatgc
gtcgcccaggacggtcgcgagatcgctcgtgggctgagtaactacagtgccatcgaagcc
cagaaaatcattggtcactcttccgaatccatcgtgcgcgagctgggctatatggccgag
cccgagctgattcatcgggataacctgatcctcgtctga

DBGET integrated database retrieval system