KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0756Help
Entry
Psyr_0756         CDS       T00246                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
860916..861716
Genome map
AA seq 266 aa AA seqDB search
MSDILNKIKHYKLQEIEAAKADLPFSRLEQRALEQSSPRGFYKALKAKEQQGLIGLIAEI
KKASPSKGLIREDFNPPELAKAYETGGAACLSVLTDTPSFQGSPQFLIDARNACALPVLR
KDFMFDTYQVYEARAWGADCILLIMASLSDDLAAELESAAMTLGMDVLVEVHDEHEMERA
LKLSSPLLGVNNRNLHTFEVDLGTSERLASMVPAGKLLVGESGIGNHNDCLRLKKSGITT
FLVGESLMRKEDVVAATRTLLTGSAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattctaaacaaaataaaacattacaaacttcaggaaatagaggcggcgaaa
gctgacttgccattcagccgcctcgaacagcgtgccctcgaacagtccagcccacgcggt
ttttataaagcactgaaagcaaaagagcagcagggtctgatcggcttgattgcagaaata
aaaaaagccagtccatcaaaaggtctgattcgcgaagacttcaaccctcctgaactggcg
aaggcttacgaaaccggtggcgctgcctgtttatccgttctgaccgacacgccaagcttc
cagggctcgccgcagtttctcattgacgcgcgaaacgcttgcgcccttcctgtgttacga
aaagacttcatgtttgatacgtatcaggtgtatgaggcacgtgcctggggcgcggactgc
atattgctgatcatggcttcattgagtgatgacctggctgccgaacttgaaagtgctgcc
atgacgctggggatggacgtccttgtggaagtgcatgacgaacatgaaatggagcgtgcg
ctgaaactgtcttccccgctgctcggcgtcaataatcgcaacctgcataccttcgaagta
gacctcggcacaagcgagcgactggcatccatggtgcccgcaggcaaactgctggtcggc
gaaagtggtatcggcaaccataatgattgcctgcgactcaagaagtccggcatcactacc
tttctggtcggcgaaagcctgatgcgcaaagaagatgttgtggcggcgacaagaacactg
ctgaccggcagtgcggactga

DBGET integrated database retrieval system