KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0771Help
Entry
Psyr_0771         CDS       T00246                                 

Definition
peptidase M20:peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psb01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(875599..876741)
Genome map
AA seq 380 aa AA seqDB search
MLDDPIALTRALLAFQTLNPPGDEEACAAFLAEQLTRHGFVCELQRFGERRFNLVAWLEG
DGPGKPLGFTGHLDTVPLGNATWSHSPFAGEIVDGRLYGRGSSDMKAGIAAFIVACQRSR
DSIRRGPGVRLILTGGEETGCDGAKALCSDAPHLLGELGALLIGEPTANYPILGHKGALW
LCCASHGLTAHGAMPEEGVNAIYLAAEHIGRAQTFEVGPAHPLMRKPTLNVGTISGGLNI
NSVPDYAAFTLDLRTAPNLDHDEIRGRLAAHLGSSAELSTLIDLPGICASPDEPWVQQVF
ARCQALHDAPLEEKAVPYFTDAAVLLPAIGYPPTLILGPGEPGMAHKVDEYCEVDKLQQC
VELYAGLIEDWTVMHAPMND
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgaccctatagccctgacccgagccctgctggcgttccagaccctcaacccg
ccgggcgatgaagaagcgtgtgcggcttttcttgccgagcagctgacccgccacggattt
gtctgcgagctgcagcgtttcggtgagcgccgtttcaatctggtcgcctggcttgagggc
gacggccccggcaaaccgctggggttcaccggccacctggataccgtgccgctcggcaat
gccacctggagtcactcgccgtttgccggtgagatcgtcgatggccggctgtacgggcga
gggtccagcgacatgaaagcgggcattgccgccttcatcgtggcctgccagcgcagccgt
gattccattcggcgcgggcccggcgttcgtctgatactcaccggcggagaggaaaccggc
tgtgacggcgccaaggccctgtgcagtgacgcgccccatttgcttggcgaactgggcgca
ctgctgatcggagagccgacggccaactacccgatactcggacacaaaggcgcgttatgg
ctgtgctgcgccagccatggcctgacggcccacggagcgatgccggaagaaggcgtgaac
gctatctatctggccgccgaacacattggccgcgcacagacctttgaagtaggccccgcg
catccgctcatgcgcaagccgacgctgaacgtcggcactatcagcggcggtctgaacatc
aactcggtgccggactacgcagcgttcaccctggacctgcgcactgcaccgaatctggac
cacgacgagattcgcggacgactggcggcccatctgggcagcagcgcggaactgagcacc
ctgattgatctgcctggtatctgtgccagccccgacgagccttgggtgcaacaggttttt
gcacgctgtcaggccttgcatgacgcccctctggaggaaaaggcggtgccctactttacc
gatgccgcggtgctgctccccgccatcggctatccgcccacccttattctcggcccggga
gagcccggcatggcgcacaaggtcgatgagtattgtgaagtcgacaaacttcagcaatgc
gtcgaactgtatgccggattgatcgaagactggacagtcatgcacgcgccgatgaacgac
tga

DBGET integrated database retrieval system