KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0829Help
Entry
Psyr_0829         CDS       T00246                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(938719..939225)
Genome map
AA seq 168 aa AA seqDB search
MNEPLLATERVYIGLGSNLADPAEQLRSALKAIAQLPDCQLSGVSSFYISDSLLPGQPRF
TNAVAAIDTALAPLALLDALQAIELDQGRERHERWGPRTLDLDILLFGDHLIDEPRLKVP
HYHMQARAFVLYPLAELAPGLTLADGRPLNRLLDECPFTGLERLPAEA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaaccgctgttggccactgaacgcgtgtacatcggtctgggcagcaatctggct
gaccctgccgagcaattgcgcagcgccctcaaggccattgcgcagttacccgattgtcag
ttgagcggcgtgtcgtccttctatatcagcgactcgctgctgcccggccaaccgcgcttc
accaatgccgtcgcggcaatcgataccgctctggcgcccctggcgctgcttgatgcgcta
caggccatcgaactggaccagggccgtgaacgccacgaacgctgggggccacgcacgctg
gacctcgatattctgctgttcggcgaccatcttatcgatgagccacgcctcaaggtgccg
cattaccacatgcaggccagggcattcgtgctgtacccgctggcagagctggctccgggg
ctgacactggccgacgggcgcccactgaatcgtctactcgatgaatgcccgttcacaggt
cttgagcgtctgcccgccgaggcatga

DBGET integrated database retrieval system