KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1010Help
Entry
Psyr_1010         CDS       T00246                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Psyr_1010
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psyr_1010
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Psyr_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1144436..1144924
Genome map
AA seq 162 aa AA seqDB search
MSAFHDIKLKALGGQELPLANFRKKVVLVVNVASKCGLTPQYAALENLYQQYKDQGLEIL
GLPCNQFAGQEPGTEQEIAEFCQLNYGVTFTLGEKLDVNGPNRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKNGGVSARFSPRTTPDDPAVIQAIEKALAQS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttttcacgacatcaaattgaaagcgctgggtggccaggaactgccgctggcg
aatttcagaaaaaaagtggttctggtagtcaacgtcgcgtccaaatgcgggctgacaccg
cagtacgcggcacttgaaaacctctatcagcagtacaaggaccagggcctggagatactg
ggtctgccgtgcaaccagtttgccgggcaggaaccgggtaccgagcaagagatcgccgaa
ttttgccaactcaactatggcgtgacgtttacgctgggtgaaaaactcgacgtcaacggc
cccaaccggcactcgctttaccgtttgctggcgggcgagggtgccgagtttcccggggat
atcacctggaacttcgaaaagtttctggttggcaagaacggcggtgtaagcgcacgtttt
tctccgcgtactactccggatgatcctgcggtgatccaggccatcgaaaaggccctggcg
caaagctga

DBGET integrated database retrieval system