KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1090Help
Entry
Psyr_1090         CDS       T00246                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Psyr_1090
   00240 Pyrimidine metabolism
    Psyr_1090
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Psyr_1090
   03430 Mismatch repair
    Psyr_1090
   03440 Homologous recombination
    Psyr_1090
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Psyr_1090
DNA replication proteins [BR:psb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Psyr_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1232170..1232598)
Genome map
AA seq 142 aa AA seqDB search
MTQVDFYILPSADPAARLDFACKLTEKAWRLGHKVYLHCSDAAQREDLDARLWRFRGEVF
LPHGDAESDHDAAVVLGLGDDSGEHSDLLVNLDLSIPAFFKRFARVAEVVVEDPAIRLAA
RESFRSYREQGYPPQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgacttctacatcctgcccagcgccgatcctgcggcccgcctggatttt
gcctgcaagctgacggaaaaggcctggcgcctgggtcacaaggtctatctgcattgcagc
gatgctgcgcagcgtgaggacctcgatgcccggctctggcgtttcagaggcgaagtgttc
ctgccccatggcgacgccgagagcgatcacgatgcggccgtggtactgggtctgggcgac
gactcgggcgaacacagcgacctgctggtcaatctcgacctgagcattccggccttcttc
aaacgtttcgcccgcgtggccgaagtcgttgtcgaagacccggccatacgtcttgccgca
cgcgagagtttccgttcctaccgcgaacagggctatcctccgcaagatcaccgactgcag
cgcctttga

DBGET integrated database retrieval system