KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1110Help
Entry
Psyr_1110         CDS       T00246                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyr_1110 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_1110 (glk)
   00052 Galactose metabolism
    Psyr_1110 (glk)
   00500 Starch and sucrose metabolism
    Psyr_1110 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Psyr_1110 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psyr_1110 (glk)
   00524 Butirosin and neomycin biosynthesis
    Psyr_1110 (glk)
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psyr_1110 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1257902..1258867
Genome map
AA seq 321 aa AA seqDB search
MKLALVGDIGGTNARFAIWENSTLHSVRVFPTIDYAGPEKAIEVYLQDLELQRGDIGHVC
LAVAGPVDGDFFQFTNSHWQLSREAFCADLQVDELLLINDFTAMALGMTRLKDDEYLTVC
HGVGKPDRPRVVVGPGTGLGVGTLIKLEGSRWMALPGEGGHADLPIGTAREALLWTRLMA
EHEHVSAEVVLSGAGLLLLYQVSCALDDIEPVLKSPAAITTAALSGDPVAAAVLEQFCVF
LGRVVGNHVLALGSLGGVYIVGGVVPRFTEFFINSGFKRAMAEKGVMSDYFKGLPVWLVT
AEYPGLMGSGVALQQAFGAQI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttggccctggtcggtgatataggcggtaccaatgcacgttttgccatttgggaa
aacagcacgctgcattctgtccgggtattcccgaccattgactacgcgggtccggagaag
gccatcgaagtctatctgcaagacctggagctgcagcgcggcgatatcggtcatgtatgc
ctggcggtcgccggaccggtcgacggtgatttttttcagttcaccaacagccactggcaa
ttgagccgcgaggcgttctgcgccgacctgcaggtcgatgaactgctgttgatcaacgac
ttcaccgccatggcgctgggcatgacccggctcaaggacgatgaatacctgacggtctgc
cacggtgtcggcaagcctgaccgcccgcgcgtggtggtggggccggggaccgggctgggc
gtcggtacgctgatcaaactcgaaggcagtcgctggatggcgttgccgggcgagggcggg
catgccgatctgcccatcgggactgcgcgcgaggcgctgctgtggacacggctgatggcc
gagcacgagcatgtcagcgccgaggtcgttctcagcggtgccggcttgctgttgctgtat
caggtcagttgcgcgctggacgatatcgaaccggtgctcaaatcgcctgcggcgatcacc
accgccgcgctctcgggcgacccggtagccgcggcagtcctggagcaattctgcgtgttt
ctcggcagagtggtcggcaaccatgtgctggccctgggcagcctcggcggggtttatatc
gtcggtggcgtggtgcctcgttttactgagttcttcatcaacagcgggttcaagcgcgcc
atggccgagaagggcgtcatgagcgactatttcaaaggtctgccggtgtggctggtaacg
gccgaataccctggcctcatggggtcgggcgtggccctgcaacaggcgtttggtgcgcag
atctga

DBGET integrated database retrieval system