KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1289Help
Entry
Psyr_1289         CDS       T00246                                 

Definition
glutaredoxin
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
Enzymes [BR:psb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Psyr_1289
Secretion system [BR:psb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Psyr_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1453992..1454732
Genome map
AA seq 246 aa AA seqDB search
MRLPQIFAAAALMLAGTFSMSALADAAPDQAIRKTLDSLELQLPVESISPSPLNGLYEVK
LKGGRVLYASADGQFVVQGYLFQVQNGKPVNLTEKTERLAISKTINAIPASEMVIYPAVG
ETKSHITVFTDTTCPYCHKLHEEVGQLNKMGVEVRYLAFPRQGLGSPGDEQLQAVWCSKD
RKGAMDRMVDGKDIKAAKCDNPVSKQYELGQSIGVNGTPAIVLADGQVIPGYQPAAQVAK
LALSAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgccacagattttcgctgccgcggctttgatgctggccggcaccttcagtatg
tctgccctggctgatgcagcccccgatcaggctatccgcaagacgctcgactcgctggaa
ttgcagctgccggtcgagagtatctcgccgagcccgctcaatggcctctatgaagtgaag
ctcaagggcggccgcgtcctgtacgccagcgccgacggtcagttcgtggttcagggctat
ctgtttcaggtgcagaacggcaagccggtcaacctgaccgagaagaccgaacgtctggcc
atttccaagaccatcaacgccattcctgcgtccgagatggtgatctatccggcggtgggc
gagaccaagtcgcacatcaccgtattcaccgacacgacctgcccgtattgccacaagctg
cacgaagaagtcggccagctgaacaagatgggtgtcgaagtccgttacctggcattcccg
cgtcaggggcttggttctccgggtgacgagcagttgcaggccgtgtggtgttccaaggat
cgcaagggcgcgatggaccgtatggtcgatggcaaggacatcaaggccgccaaatgcgac
aatccggtcagcaagcaatatgagctcggtcagtcgatcggcgtcaacggcacgcctgcg
attgtcctcgctgacggtcaggtgattccgggttatcagcctgcggctcaggttgccaag
ctggcattgagcgccaaataa

DBGET integrated database retrieval system