KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1291Help
Entry
Psyr_1291         CDS       T00246                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psb00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:psb00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1456278..1457687
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLTGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVAGSIPDADFKKILEETYGVFAHSAVAPLRQLHGNEWVLELFHGPTLAFKDFALQLLG
RLLDYILAKRGQRVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPNNRVSDVQRRQMTTI
FGDNIHNIAVEGNFDDCQEMVKASFADQSFLKGTPLVAVNSINWARIMAQIVYYFHASLQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDMHGRNGAAIAELMSTFRQGGGFSVEEERWTETRKLFDS
LAVSDEDTCTTIAEVFASTGELLDPHTAIGVKAARECRRSLDTPMVILGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFERDERCTVLPNDLKAIQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtactcgcgggcaagcgcctgcattgaatttcgaagacgtgctgttg
actggtctggccagcgatggtggcctctatgtgccggaaaacctgccgcgcttcacgcag
gaagagatcgcttcctgggcaggtctgccttatcacgaactcgccttccgggtgatgcgc
cccttcgtggcgggcagcattccggatgccgacttcaaaaagattctcgaagagacctac
ggcgtgtttgcccacagtgctgttgcgccgctgcgccagctgcatggcaacgagtgggta
ctcgaactgttccatggcccgacgctggcgttcaaggacttcgcactgcaactgctcggc
cgcctgcttgactatattctggccaagcgtggccagcgtgtcgtgatcatcggtgcaacc
tcgggcgacaccggttctgcggccatcgaaggctgccgtcgctgcgacaacgtcgacatc
ttcatcctgcacccgaacaaccgggtgtccgatgtacaacgtcggcagatgaccactatc
ttcggtgacaacatccataacatcgcagtcgaaggcaacttcgacgactgccaggaaatg
gtcaaggccagcttcgctgaccagagcttcttgaagggcacaccgttggtcgcggtcaac
tcgatcaactgggcgcggatcatggctcagatcgtctactacttccacgcgtcgctgcag
ttgggcggacctgcgcgttcggtatcgttctcggtaccgaccggtaatttcggcgatatc
tttgccggttatctggcgcgcaatatgggcctgccgatcaatcagttgatcgttgccacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaatcagtacgtcaaggaaaccctg
cacgccacgctgtcgccttccatggacatcatggtgtcgtccaacttcgagcgcctgctg
ttcgacatgcacggtcgcaacggcgctgccattgccgagttgatgagcacgttccgccag
ggtggcggtttcagcgtcgaggaagagcgctggaccgagacccgcaaactgttcgattcg
ctggcagtcagtgacgaggacacctgcacgaccatcgccgaagtgttcgccagcactggc
gagttgctcgacccgcataccgctatcggggtgaaggctgcgcgtgaatgccgacgcagt
ctggacacgccgatggtgattctgggcaccgcgcatccggtcaagtttccggaagcggtt
gagaaagccggtgtaggaaaagcgcttgaactacctgcacatttgtctgatttgttcgag
cgcgacgagcgctgtacggttctgccaaatgacctgaaagccatacaggcgtttgtcagc
cagcacggcaatcgcggcaaaccgctctga

DBGET integrated database retrieval system