KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1308Help
Entry
Psyr_1308         CDS       T00246                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyr_1308
Enzymes [BR:psb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psyr_1308
Two-component system [BR:psb02022]
 CheA family
  WspE-WspRF
   Psyr_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1484946..1485956
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPMAIEALRRALAFEPAHQIIWVASNGADAVQRCVEQTPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDHEQNMRRVFEAMGHGALDVVDTPAIGGPNPKEAAAPLL
RKILNIDWLIGQRVGLERVAATPRAAPSRRDRLVAIGSSAGGPAALEILLKALPVSFPAA
IVLVQHVDQVFAAGMADWLSSASGLPVRLAREGETPQPGVVLLAGTNHHIRLLKDGTLAY
TAEPVNEVYRPSIDVFFESVTRYWSGEAIGVLLTGMGRDGAQGLKAMRERGFLTIAQDQA
SSAVYGMPKAAAAIDAAVEIRPLPAIAPRLIEVFTQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgccatcgtcaacgatatgcccatggccatcgaagccctgcgccgtgcgctg
gccttcgagcccgcgcatcagatcatctgggtggcgtccaatggtgccgacgccgtgcag
cgttgcgtcgagcagaccccggacctgatcctgatggacctgatcatgccggtgatggat
ggcgtggaagccacgcgccggatcatggccgaaacaccctgcgccatcgtcatcgtgacc
gtcgaccacgagcagaacatgcgtcgcgtgttcgaagcgatggggcacggcgcgctggat
gtggtggacacgccggccattggtggtcccaatccaaaagaggcggcggcgccactgctg
cgcaagatcctcaatatcgactggctgatcggccagcgtgtcggcctcgaacgggttgcg
gctacaccgcgcgccgcgccctcgagacgcgatcggcttgtggcgatcggctcctcggca
ggcgggcctgccgcgctggagattctgctcaaggcgcttccggtgagctttcctgcagcg
atcgtccttgtgcagcacgttgatcaggtcttcgccgccggtatggccgactggttgagt
tccgcctccggcctgccggtacggctggcaagggaaggcgaaacgccacagccgggtgtg
gtgttgctggcaggcaccaatcatcatatccgcttgctcaaggacggcacgctggcgtac
acggcggagccggtgaatgaagtttacaggccctcgattgatgtgtttttcgagagcgta
acccgttattggagtggcgaggcgatcggcgttctgctgaccgggatggggcgcgacggt
gcacagggactcaaggccatgcgtgaacgggggtttctgaccatcgctcaggatcaggcc
agttctgctgtgtatggcatgcccaaggccgccgcagccatcgatgctgccgtggaaatc
cgtccgttgcccgccatagcacctcgcttgatcgaggtatttactcaatga

DBGET integrated database retrieval system