KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1372Help
Entry
Psyr_1372         CDS       T00246                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
Enzymes [BR:psb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Psyr_1372 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1554845..1555522
Genome map
AA seq 225 aa AA seqDB search
MSREQDDLLRRGIGMTSQRTRERLIQRLCEEGISNQRVLDVIRKTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLAAGPLDKVMEIGTGSGYQTAVLAQLVERVFSVE
RIKGLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRLVIPVGSGEVQQLMLIIREENGFSRHVLGAVRFVPLLNGPIA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgagcaggatgatttattgcgtcgagggatcggaatgacgtcgcagcgtacc
cgcgagcgtctgattcaacgcctctgtgaagagggcatttccaatcagcgggtactggac
gtcattcgcaagacgccccggcatctgtttgtcgatgaagcgctggcgcatcgcgcctac
gaagacaccgcattgcccatcggccacaaccagacgatatcccagccctacatggtcgcg
cggatgagcgagctgctgctggcagcagggccgctggacaaggtcatggagatcggtaca
gggtccggctatcagaccgctgtgctcgcccagctggtagagcgagtgttttcggtcgag
cgcatcaaggggctgcaggatcgcgccaaggagcgtctggtcgagctcaatctgcgcaac
gtggtttttcgctggggtgacggctgggagggctggccagccctggcgccgtataacggc
atcatcgtcacggcggtggcaaccgatgtaccgcaggcattgctcgatcaactggcaccg
ggaggccgtctggtcatccctgttggctctggggaggttcagcagttgatgctgatcatt
cgtgaagaaaacggtttttcccggcatgtgctgggggctgtgcgcttcgtacccttgctc
aacgggcccatcgcttga

DBGET integrated database retrieval system