KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1845Help
Entry
Psyr_1845         CDS       T00246                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2123976..2124521)
Genome map
AA seq 181 aa AA seqDB search
MTLEQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYTQTLEEVTNGALFSSDASE
MVMVKDIELYSLCEHHLLPFIGKAHVAYIPQGKVLGLSKVARIVDMYARRLQIQENLSRQ
IAEAIQQVTGALGVAVVIEAKHMCMMMRGVEKQNSAMITSVMLGEFRENAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgacactggaacagaattacaccgccatcctcgggcaactgggcgaggacgtctcgcgc
gaaggtctgctggacacccccaagcgcgccgccaaggccatgcagtatctgtgtcgcggt
tacacgcagaccctggaagaagtgaccaacggcgcgctgttcagctccgatgccagtgaa
atggtgatggtcaaggacatcgagctgtactcgctgtgcgagcaccatctgctgccgttc
attggcaaggctcatgtggcctacatcccgcagggcaaggtgcttggcttgtcgaaagtg
gcgcgtatcgtcgacatgtatgcccgccgtctgcagatccaggaaaacctcagccgccag
atcgccgaggccatccagcaggtcaccggcgcgctgggcgttgcggtggtgatcgaagcc
aagcacatgtgcatgatgatgcgtggcgtcgagaagcagaactcggccatgatcacctcg
gtgatgctgggcgaattccgtgaaaacgcggccacccgcagtgagtttctcagcctgatc
aagtga

DBGET integrated database retrieval system