KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1856Help
Entry
Psyr_1856         CDS       T00246                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psyr_1856
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Psyr_1856
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Psyr_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2133956..2134501
Genome map
AA seq 181 aa AA seqDB search
MSSLSVYHVSSPDMPNKVLTHLEDIASTLAEHGVAFDRWEAATPITPGASQEEVISAYRT
QIDTLMTERGYVTVDVISLNSDHPQKAELRARFLEEHRHGEDEVRFFVAGRGLFTLHIDD
YVYAVLCEKNDLISVPAGTRHWFDMGENPHFVAIRLFNNPEGWVANFTGEDIAGRFPRLE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcctgtccgtttatcacgtttcaagccctgatatgcccaacaaggtgctgacc
catctggaagacatcgcgtcgacactggccgagcacggcgtggcgttcgaccgttgggaa
gccgcgacgccgatcactcccggtgccagtcaggaagaggtgatcagcgcctatcgcacg
cagatcgacacgctgatgaccgaacgcggttatgtcaccgtggacgtcatcagtctcaac
agcgatcacccgcaaaaagccgaattgcgcgccaggtttcttgaagagcaccgccacggc
gaagacgaggtacgctttttcgtcgccgggcggggcttgttcaccttgcacatcgacgac
tatgtgtatgccgtgctgtgcgaaaagaacgacctgatttccgtaccggccggcacgcgg
cactggttcgatatgggcgagaacccgcacttcgttgccatccgcctgttcaataatccg
gaaggctgggtagcaaactttaccggtgaagacattgccggccgttttccacggctggaa
gactga

  All links  
No link information was found.   
DBGET integrated database retrieval system