KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1880Help
Entry
Psyr_1880         CDS       T00246                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Psyr_1880
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyr_1880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2152766..2153134)
Genome map
AA seq 122 aa AA seqDB search
MKKTTLLLLALTLPALAKGAGDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRQA
GQQEGYVYTDAMKNSGLVWTREELRTYIKDPSAVVPGTRMKLWWMGNDERMEDLLEYLDA
NK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccacgttactcctattggcactgaccctgcctgctcttgccaagggcgcg
ggcgatgcggaggccgggaaagctgtgttcacccgcctctgctcgggttgccacaagatc
ggcccctctgcacgcagcgcatttggcccgcccctcaacggcatcattggtcgtcaggcg
gggcaacaggaaggctacgtttacaccgacgcgatgaagaactcggggctggtctggacg
cgtgaagagttgcgcacctatatcaaggacccgagcgccgttgtacctggcacccgcatg
aagctgtggtggatgggtaacgatgagcgaatggaggatctgctggaataccttgacgcc
aacaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system