KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1880Help
Entry
Psyr_1880         CDS       T00246                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psb00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:psb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2152766..2153134)
Genome map
AA seq 122 aa AA seqDB search
MKKTTLLLLALTLPALAKGAGDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRQA
GQQEGYVYTDAMKNSGLVWTREELRTYIKDPSAVVPGTRMKLWWMGNDERMEDLLEYLDA
NK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaccacgttactcctattggcactgaccctgcctgctcttgccaagggcgcg
ggcgatgcggaggccgggaaagctgtgttcacccgcctctgctcgggttgccacaagatc
ggcccctctgcacgcagcgcatttggcccgcccctcaacggcatcattggtcgtcaggcg
gggcaacaggaaggctacgtttacaccgacgcgatgaagaactcggggctggtctggacg
cgtgaagagttgcgcacctatatcaaggacccgagcgccgttgtacctggcacccgcatg
aagctgtggtggatgggtaacgatgagcgaatggaggatctgctggaataccttgacgcc
aacaagtag

DBGET integrated database retrieval system