KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1986Help
Entry
Psyr_1986         CDS       T00246                                 

Definition
aspartate-semialdehyde dehydrogenase (EC:1.2.1.11)
Orthology
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:psb01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:psb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:psb00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:psb00270]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psb00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2306109..2307221
Genome map
AA seq 370 aa AA seqDB search
MKRVGLIGWRGMVGSVLMQRMREEQDFDLIEPVFFTTSNVGGQAPSVGKDVAPLKDAYSI
DELKTLDVVLTCQGGDYTNEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRKVID
QQLDAGTKNYIGGNCTVSLMLMGLGGLFDAGLVEWMNVMTYQAASGAGAQNMRELIRQMG
AVHASVADDLANPASAILDIDRKVAEAMRSESFPTENFGVPLAGSLIPWIDKALPNGQSR
EEWKGQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPIADIEGLISQHN
PWVKLVPNNREASMHELSPTAVTGTMSIPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPL
RRMLRILLER
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtaggtctgatcggttggcgtggcatggtcggttccgtgctcatgcagcgg
atgcgggaagagcaggacttcgatctcattgagccggtgttcttcactacttccaatgtc
ggtggccaggcgccttcggtgggcaaggatgttgcgcccctgaaagatgcctacagcatc
gacgagctgaaaaccctggacgtggtgctgacctgccagggtggcgactacaccaatgag
gtgttccccaagctgcgcgaagcgggctggcagggttactggatcgatgcggcgtccagc
ctgcgcatgcaggatgatgcggtcatcgtgcttgacccggtgaaccgcaaggtcatcgac
cagcaactggacgcgggcaccaagaactatatcggtggcaactgcaccgtcagcctgatg
ctgatggggctgggcggcctgttcgatgccggtctggtcgagtggatgaacgtcatgacc
tatcaggcggcctccggcgccggcgcgcagaacatgcgtgagctgatcaggcagatgggc
gcggtgcatgcttcggtggccgatgatctggccaacccggccagcgccattctggacatc
gaccgcaaggtggctgaagccatgcgcagcgagtcgttccctaccgagaacttcggcgta
ccgcttgcgggcagcctgatcccgtggatcgacaaggccctgccaaacggccagagccgc
gaagagtggaaaggccaggccgagaccaacaagatcctcggtcgcttcaagagcccgatc
ccggtggacggcatctgcgtgcgcatcggcgccatgcgttgccatagccaggcgctgacc
atcaagctgaacaaggatgtgccgattgcggacatcgaaggtttgatcagccagcacaac
ccgtgggtcaagctggtgccgaacaaccgcgaagccagcatgcacgagctgagcccgacc
gccgtgaccggcaccatgagcattccggtagggcgtctgcgcaaactcaacatgggttcg
cagtacctgggcgctttcaccgtgggtgaccagctgttgtggggcgctgcggagccgctg
cgtcgcatgctgagaatcctgctggagcgttga

DBGET integrated database retrieval system