KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1986Help
Entry
Psyr_1986         CDS       T00246                                 

Definition
aspartate-semialdehyde dehydrogenase (EC:1.2.1.11)
Orthology
K00133  
aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Psyr_1986
   01230 Biosynthesis of amino acids
    Psyr_1986
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psyr_1986
   00270 Cysteine and methionine metabolism
    Psyr_1986
   00300 Lysine biosynthesis
    Psyr_1986
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Psyr_1986
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     Psyr_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2306109..2307221
Genome map
AA seq 370 aa AA seqDB search
MKRVGLIGWRGMVGSVLMQRMREEQDFDLIEPVFFTTSNVGGQAPSVGKDVAPLKDAYSI
DELKTLDVVLTCQGGDYTNEVFPKLREAGWQGYWIDAASSLRMQDDAVIVLDPVNRKVID
QQLDAGTKNYIGGNCTVSLMLMGLGGLFDAGLVEWMNVMTYQAASGAGAQNMRELIRQMG
AVHASVADDLANPASAILDIDRKVAEAMRSESFPTENFGVPLAGSLIPWIDKALPNGQSR
EEWKGQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPIADIEGLISQHN
PWVKLVPNNREASMHELSPTAVTGTMSIPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPL
RRMLRILLER
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtaggtctgatcggttggcgtggcatggtcggttccgtgctcatgcagcgg
atgcgggaagagcaggacttcgatctcattgagccggtgttcttcactacttccaatgtc
ggtggccaggcgccttcggtgggcaaggatgttgcgcccctgaaagatgcctacagcatc
gacgagctgaaaaccctggacgtggtgctgacctgccagggtggcgactacaccaatgag
gtgttccccaagctgcgcgaagcgggctggcagggttactggatcgatgcggcgtccagc
ctgcgcatgcaggatgatgcggtcatcgtgcttgacccggtgaaccgcaaggtcatcgac
cagcaactggacgcgggcaccaagaactatatcggtggcaactgcaccgtcagcctgatg
ctgatggggctgggcggcctgttcgatgccggtctggtcgagtggatgaacgtcatgacc
tatcaggcggcctccggcgccggcgcgcagaacatgcgtgagctgatcaggcagatgggc
gcggtgcatgcttcggtggccgatgatctggccaacccggccagcgccattctggacatc
gaccgcaaggtggctgaagccatgcgcagcgagtcgttccctaccgagaacttcggcgta
ccgcttgcgggcagcctgatcccgtggatcgacaaggccctgccaaacggccagagccgc
gaagagtggaaaggccaggccgagaccaacaagatcctcggtcgcttcaagagcccgatc
ccggtggacggcatctgcgtgcgcatcggcgccatgcgttgccatagccaggcgctgacc
atcaagctgaacaaggatgtgccgattgcggacatcgaaggtttgatcagccagcacaac
ccgtgggtcaagctggtgccgaacaaccgcgaagccagcatgcacgagctgagcccgacc
gccgtgaccggcaccatgagcattccggtagggcgtctgcgcaaactcaacatgggttcg
cagtacctgggcgctttcaccgtgggtgaccagctgttgtggggcgctgcggagccgctg
cgtcgcatgctgagaatcctgctggagcgttga

DBGET integrated database retrieval system