KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2212Help
Entry
Psyr_2212         CDS       T00246                                 

Definition
(RefSeq) arginase/agmatinase/formiminoglutamase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psyr_2212
  Amino acid metabolism
   00220 Arginine biosynthesis
    Psyr_2212
   00330 Arginine and proline metabolism
    Psyr_2212
Enzymes [BR:psb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Psyr_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(2570727..2571617)
Genome map
AA seq 296 aa AA seqDB search
MTTHPDKTLRLIFPQWQGGNNAPYHFGAQLLAWLAPDTSGPVEHVAVTEPDDQPLELENG
IIARHALLAQLDLARQLIDRHQPDRLVVLGGDCLVDLAPFAYLNERYDGDLAVLWVDAHP
DVMTPRDFQHAHAMVMGNLLGEGDKDFVDAVKRPVKPANVMYAGLQETLEVETAFIKRLR
LRSAGAQALAHSSEPVLQWLEDIGARHLAIHLDLDVLDPALFRSLLFAQPGVPASDFEGV
AQGKMTIEQVVRLLTDVASVVDVVGLGIAEHLPWDALALKNMLMKLPLLGDRAANP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactacccaccccgataaaaccctgcgcctgatctttccccagtggcagggcggcaac
aacgcaccttatcattttggcgcacaactgctggcgtggctggcaccggacacgtcaggg
cctgtcgagcacgtggccgtaaccgaacccgatgatcaaccacttgaactggaaaacggc
attatcgcccgccatgcgttgctcgcgcagcttgaccttgcacggcaactgatcgaccgg
catcagccggatcggctggtggttctgggtggcgactgtctggtcgacctcgcgccattc
gcctacctgaatgaacgttacgacggtgaccttgcggtgctgtgggtcgacgctcacccg
gacgtcatgacacccagagacttccagcatgcgcatgcgatggtcatgggcaatctgttg
ggcgaaggtgacaaggatttcgtcgacgcggtgaaacgccctgtcaagccggccaatgtg
atgtatgcaggcctgcaggagaccctcgaggtagaaaccgcgttcatcaaacgtctccgg
ctgcgcagtgccggtgcccaggcgctggcccactccagcgagccggtgctgcagtggctt
gaggacatcggggcaaggcacctggcgatccatctggacctggacgtgctggacccggca
ctgtttcgttctctgctgtttgcccaacccggtgtcccggccagtgactttgaaggcgtt
gctcagggcaagatgactatcgagcaggtggtccgcttgctgacagacgtcgccagcgtc
gtggacgtggtcggacttggcattgccgaacacctgccatgggatgctctggcgttgaag
aacatgctgatgaaactgccgctgctcggcgaccgggctgccaacccatga

DBGET integrated database retrieval system