KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2452Help
Entry
Psyr_2452         CDS       T00246                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00071  Fatty acid degradation
psb00280  Valine, leucine and isoleucine degradation
psb00281  Geraniol degradation
psb00310  Lysine degradation
psb00360  Phenylalanine metabolism
psb00362  Benzoate degradation
psb00380  Tryptophan metabolism
psb00410  beta-Alanine metabolism
psb00627  Aminobenzoate degradation
psb00640  Propanoate metabolism
psb00650  Butanoate metabolism
psb00903  Limonene and pinene degradation
psb00930  Caprolactam degradation
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
psb01212  Fatty acid metabolism
Module
psb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psyr_2452
   00650 Butanoate metabolism
    Psyr_2452
  Lipid metabolism
   00071 Fatty acid degradation
    Psyr_2452
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psyr_2452
   00310 Lysine degradation
    Psyr_2452
   00360 Phenylalanine metabolism
    Psyr_2452
   00380 Tryptophan metabolism
    Psyr_2452
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psyr_2452
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psyr_2452
   00281 Geraniol degradation
    Psyr_2452
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psyr_2452
   00627 Aminobenzoate degradation
    Psyr_2452
   00930 Caprolactam degradation
    Psyr_2452
Enzymes [BR:psb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psyr_2452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 3367969
NCBI-ProteinID: YP_235529
UniProt: Q4ZTN1
Position
2840775..2841587
Genome map
AA seq 270 aa AA seqDB search
MTDYQSFRVDLADSIAHVQINRPEKLNAMNESFWTEIIAIFDWIERTDEVRVVVLSGAGK
HFSSGIDLALLASVASQMGKDAGRNARLLRRKIRDMQASFTAVDNCRKPVLAAIQGYCLG
GAIDLISACDMRYAAADAQFAIREIDMGMAADVGTLQRLPRIIGDGVLRELAYTGRTVGA
EEAQRIGLVNRTFDDADGLLQGVLAVAREIAGKSPIAIEGTKQMISYMRDHRVEDGLEHV
AIWNAAMLQSPDLKLAMAAQMSKHKPVFDN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgattatcaaagtttccgggtcgatctggccgacagcattgctcacgtacaaatc
aaccggcccgaaaaactcaacgcaatgaacgagtcgttctggacggagataatcgccatt
ttcgactggatagagcgtaccgacgaggtgcgcgtcgtggtgctcagcggtgcgggcaag
cacttttcgtcaggcatcgatctggcactgctggcctcggtcgccagccagatgggcaag
gatgccgggcgtaacgcccgcctgttgcggcgcaagatccgtgacatgcaggcttcgttc
actgccgtggacaattgccgaaaaccggttctcgccgccatccagggctattgcctgggc
ggcgccatcgacctgatttccgcgtgtgacatgcgttacgcggcggccgacgcgcagttc
gccattcgcgagatcgacatgggtatggccgctgatgtcggcacgctgcaacggctgcca
aggatcatcggtgatggtgtgttgcgcgaactggcctacaccgggcgtaccgtcggcgct
gaagaggcgcaacgcatcgggctggtcaatcgcaccttcgatgacgcggacggtctgttg
cagggtgtcctggcggtggctcgggaaatagccggaaagtcgcccatcgccatcgaaggc
accaagcaaatgatcagctacatgcgtgatcacagagtggaagatggtctcgaacacgtt
gccatctggaacgcagccatgctgcaatcacctgacctgaagctggcgatggctgcgcag
atgagcaagcacaagccagtctttgataattga

DBGET integrated database retrieval system