KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2491Help
Entry
Psyr_2491         CDS       T00246                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psyr_2491
Enzymes [BR:psb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Psyr_2491
Exosome [BR:psb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyr_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2897665..2899890
Genome map
AA seq 741 aa AA seqDB search
MNAPDKTGTRRRAIPAAVDLDALIRAEHRDPFSILGPHGDGGSGQYVRAYLPAALSVRLL
ARDDGRELGEMEMSEVPGFFVGHLEHPQPYLLKINWAGGEQITEDPYSFGPLLGEMDLYL
FAEGNHRDLSSCLGAQVTSVDGVDGVRFAVWAPNARRVSVVGSFNSWDGRRHPMRMRHPT
GVWEIFVPRLQPGEVYKYEILGAHGILPLKSDPMALSTTLPPDTASKIAAPLQFEWNDQE
WLQSRAGRHEVTAPLSIYELHAGSWQMEQVEDNQWRQYNWRELADRLIPYVKELGFTHIE
LMPIMEHPFGGSWGYQLLAQFAPTARYGSPEDFAFFVDACHRAEIGVILDWVPAHFPTDT
HGLAQFDGTCLYEYADPKEGFHQDWNTLIYNLGRTEVHGFMLASALHWLKHYHIDGLRVD
AVASMLYRDYSRNAGEWVTNRFGGRENLEAIDFLRHLNDVVALEAPGTMVIAEESTAWPG
VSEPTQQGGLGFNYKWNMGWMHDSLQYMEEDPINRGHHHGKLSFSLVYAWSERFVLPISH
DEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGCEFGQWREWNHDRELD
WYLMQYAEHVGVKNLVGDLNRLYREEKALHERDADPAGFQWLVGDDSANSVFAYLRWSND
GEPLLVVANMTPVPRLDYRLGAPMRGAWTELLNSDAETYAGSNFGNGGEVMTEAEPAHGM
EDSLVLNLPPLAVLILKPKKD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcctgacaaaaccggcacgcgccgccgcgcgattcccgctgctgtggacctc
gacgcgctgatccgtgctgaacaccgtgacccgttctctatcctcggcccgcatggtgat
ggcggcagcgggcagtacgtccgcgcctacctgcccgcagcgttgagtgtccgtctgctg
gccagggatgacggtcgtgaactgggcgagatggaaatgagcgaagtgccggggtttttc
gtcggccacctcgagcacccgcagccttacctgctgaaaatcaattgggctggcggtgaa
cagatcaccgaagacccttacagctttggcccgctgctgggcgagatggacctttacctg
tttgccgagggtaatcatcgcgacctgagcagctgtctgggcgcgcaagtcaccagcgtc
gatggcgtggacggtgtgcgttttgcggtctgggcacccaatgcgcgtcgtgtttcggtg
gttggcagcttcaacagctgggatggacgtcgccatcccatgcgcatgcgccacccgacc
ggcgtatgggagattttcgtcccgcgtctgcagcccggcgaggtctataagtacgagatt
ctcggtgctcacgggattctgccgttgaaaagcgatccgatggccttgtccaccacattg
ccgcccgataccgcgtcgaagatcgctgcgccattgcaattcgaatggaatgaccaggag
tggctgcagtcgagggcagggcgccacgaagtcactgcaccgctgtcgatctacgagttg
cacgcaggctcctggcaaatggagcaggtcgaagataatcaatggcggcagtacaactgg
cgtgaactggctgatcgcctgattccttacgtcaaggaacttggcttcacgcacatcgaa
ctgatgccgatcatggaacacccattcggtggttcatggggctatcagttactggcccag
ttcgcgccaaccgcccgttacggttcgccggaagatttcgcctttttcgtcgatgcctgt
caccgggctgaaatcggcgtcattcttgactgggttccagcgcactttccgaccgatacc
catggtctggcgcagttcgacggtacttgcctgtatgagtacgcggaccccaaggaaggc
ttccatcaggactggaacacgctgatctataacctgggacgcaccgaggttcatggtttc
atgctggcctcggcactgcactggctcaagcattaccacatcgacggtctgcgcgtggat
gcggtggcgtcgatgctctaccgcgactactcgcgtaatgccggcgaatgggtgacgaat
cgcttcggcggccgcgaaaacctcgaggccatcgacttcctgcgtcatttgaacgacgtg
gttgcgctggaagcccccgggaccatggtgattgccgaagagtcgaccgcgtggccgggt
gtcagcgagccgacccagcagggcgggcttggcttcaattacaagtggaacatgggctgg
atgcatgactcgctgcagtacatggaagaggacccgatcaaccgcgggcatcaccatggc
aagctgagcttcagcctggtgtatgcgtggtccgagcgtttcgtactgcctatttcccac
gacgaagtggtgcacggcaaacattcgctgatcgacaagatgccaggcgatcgctggcag
aaattcgccaacctgcgcgcctatctgtcattcatgtggacgcatcccggcaagaagctg
ctgttcatgggctgcgaattcggccaatggcgcgagtggaatcacgacagggaactggac
tggtacttgatgcaatacgccgagcacgtgggcgtgaagaacctggtcggcgacctgaac
cgcctctatcgcgaggaaaaggcgctgcacgagcgcgatgcagaccctgccggtttccag
tggctggtcggcgatgacagtgccaacagcgtgtttgcgtacctgcgctggagcaacgac
ggcgaaccgctgctggtggtcgccaacatgaccccggtgccgcgcctggactaccgtctt
ggcgcgccgatgcgaggtgcctggacggagctgctcaacagtgacgcggaaacctacgcg
ggctccaactttggcaatggtggcgaggtcatgaccgaagccgagccggcgcatgggatg
gaggattcgctggtgctgaatctgccacccctcgcggtgctgatcctcaaaccgaagaaa
gactga

DBGET integrated database retrieval system