KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2994Help
Entry
Psyr_2994         CDS       T00246                                 

Definition
glycoside hydrolase family protein (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3587087..3589165
Genome map
AA seq 692 aa AA seqDB search
MNNEQLERLATEAGLSVHWVDANARPQTVSPDVLRKVLEALGYPAENGEAIDASLLRLQK
ASHGASAPPLLTVDVESNLDLSQWFAPQTPFTLHLEDGSSLDARLTSNAELPALAPPGYQ
QLEIAGQHLTIAVAPKTCFSMAMATDTSKPHGWGLTAQLYSLRREGDGGFGDTEALEKVL
RSAGERGADALGISPIHAMFANDPHRYSPYSPSSRLFLNSLYASPGAILGESAWRQAIED
ARVGDEMKRLETQTLIDWPAAANAKWKALHALYEGFSAGDHPLHEDFNSFRHSGGEALEN
HCRFEALCAESETLNIGNNWHEWPEQFKDPRSDAVAAFAKSHREQISFHAFAQWLIARGL
ERAQVAARSSGMRVGLIADLAVGADGAGSQAWSRQDELLSALTVGAPPDILNRAGQSWGI
SAFSPDGLKRNGFRAFIEMLRANFAHAGGLRIDHVMGLQRLWVIPQGAPPSEGAYLNFPL
DDMLRLLSLESWRHKAIVLGEDLGTVPEGLSEKLSARAILGMRVLLFEQNNGQFRPILDW
SDQALATTSTHDLPTLAGWLSELDIEWNARLGHIDEQHESQWREERTREYESLRRALSQN
IDSLPSETEDPAQIIDASISYLGHTRAPLVLLPIEDALGVEEQANLPGTIDSHPNWRRRL
PGDAASLLDNPNAARRLELLSRSRLQATERDQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgagcaactggagaggcttgcgaccgaggcaggattgtcggtgcactgggtc
gatgccaacgctcggccgcagaccgtcagccctgatgtgctgcgcaaggtactggaggcg
ctgggctatcctgctgaaaacggcgaggctatcgatgccagcctgctgcgcctgcaaaaa
gccagtcacggtgccagtgccccgccactgctgacggttgatgtggaaagcaacctggac
ctgtctcagtggtttgctccacaaacgccattcacgctacacctcgaagacggttcttcg
ctggatgccagactcacctcgaatgcagagctcccggcactggccccgcccggctatcaa
cagctggaaattgccggccagcacctgaccatcgcggtcgcgccgaaaacctgcttcagc
atggcaatggctaccgatacctcgaagccgcacggctgggggttgaccgctcagctttac
agcttgcgccgcgaaggtgatggcggctttggtgacacagaagcactggagaaggtcttg
cgctctgctggcgagcgaggtgccgacgcattgggtatcagcccgatccacgccatgttc
gccaacgaccctcaccgttacagtccttattccccttccagcaggctgttcctcaacagt
ctgtatgcgtcgccgggtgcgattctcggtgaaagtgcgtggcgtcaggcaatcgaagac
gcgcgtgtcggcgacgagatgaagcgccttgaaacacagacgctgatcgactggccagct
gcggccaacgccaaatggaaagcgcttcacgcgctttacgaaggcttcagtgcgggtgat
cacccgctgcacgaagacttcaacagcttccgccacagcggtggcgaagcgctggaaaat
cactgccgcttcgaggcgctgtgtgccgagtccgaaacgctgaacatcggcaacaactgg
catgaatggccggagcagttcaaagaccctcgcagtgacgcagtcgcagcatttgccaaa
agccatcgcgagcaaatcagctttcacgcgttcgcccaatggctcatagcccgtggtctc
gaacgcgcacaggttgcagcacgcagcagcggcatgcgcgtcggcctgattgccgacctg
gccgtgggtgccgacggtgccggaagccaggcctggagccgccaggacgagttgctgtcg
gccctgaccgtcggcgccccccctgacattctcaaccgtgccggccagagctgggggatt
tccgcgttttcgccggacggcctcaagcgtaatggttttcgtgcgttcatcgagatgctg
cgggccaactttgcccatgccggcgggttgcgtatcgaccatgtcatgggcttgcagcgt
ctctgggtcatcccgcaaggggcacctcccagcgaaggcgcttacttgaatttcccgctg
gatgacatgcttcgcctgctgagtctggaatcctggcgacacaaggcgatcgtgctgggt
gaagacctcggtacggtgccagaaggcctgagcgaaaaactcagcgccagagcgattctc
ggcatgcgcgtactgctgttcgaacagaacaatggtcagttcaggccgattctcgactgg
tcggatcaagcgctggcgaccaccagtacccacgatctgcccactctcgcaggctggctc
agcgaactggatatcgaatggaatgcccgtcttggccacattgacgaacagcatgaatcg
cagtggcgcgaagagcgcacgcgggaatatgaaagcctgcgacgtgccttgagccagaat
atcgacagtctgccctccgagactgaagacccggcccagatcatcgacgcgagcatcagc
tacctgggtcatacacgtgcgccactggtactgctgccgatagaagacgcgctgggtgtc
gaggagcaggccaacctgcccggcaccattgacagtcaccccaactggcgcagacgtctt
cccggcgatgcggcctctctgcttgataacccgaatgctgctcgacgactggaattactc
tcccgatcccggctgcaggctacggagcgtgatcaatga

DBGET integrated database retrieval system