KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3163Help
Entry
Psyr_3163         CDS       T00246                                 

Definition
serralysin (EC:3.4.24.40)
Orthology
K01406  
serralysin [EC:3.4.24.40]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
Enzymes [BR:psb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.40  serralysin
     Psyr_3163
Peptidases [BR:psb01002]
 Metallo Peptidases
  Family M10
   Psyr_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3791203..3792633)
Genome map
AA seq 476 aa AA seqDB search
MTKVKENAAIQLSAATSTSFDQINAFAHQYDRGGNLTINGKPSYSVDQAADYILRDDASW
TDRDGNGTINLTYTFLTAKPAGFDNSLGTFSAFNAQQKAQAVLSMQSWADVAKVSFTQAA
SGGDGHMTFGNYSNGSAGGAAFAYLPSGNSRTDGQSWYLVDNSYKVNTTPDNGNYGRQTL
THEIGHTLGLSHPGDYNAGEGNPSYKDATYAEDTRGYSVMSYWSESNTDQNFVKGGAPSY
SSAPLLDDITAVQQLYGANMSTRAGDTVYGFNSTAGRDFYSATSASSKVVFSVWDGGGKD
TLDFSGFTQNQKINLNAASFSDVGGMVGNVSIAKGVVVENALGGSGNDLLIGNAAANDLK
GGAGNDIIYGGGGADSLTGGAGADIFVFGASSDSNRAGQDTIRDFVSGQDKIDVSAISTL
SALQFVNAFSGHAGEAILNYNQSSNLGSLAIDFTGQGIGDFLVGTVGQALATDIVV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcaaagaaaatgctgcaatccaactttccgctgctaccagcacctctttc
gaccagatcaatgcgttcgcgcaccagtatgaccgtggcggcaacctcacgatcaatggc
aagccctcgtattcagtcgatcaggccgctgattatattcttcgcgacgacgcctcctgg
acggatcgcgatggcaacggcaccatcaacctcacttacacgttcctgacggccaaacct
gccgggttcgacaattcgctggggactttcagtgcgttcaacgcgcagcagaaagcacag
gcagtattgtcgatgcaatcctgggcagacgttgccaaggtcagcttcacccaggcagct
tccggcggcgacgggcatatgaccttcggcaactacagcaacggcagtgcaggcggggca
gcttttgcctacctgcccagcggcaacagccgtactgacggccagtcctggtaccttgtc
gataacagctacaaggtcaacaccaccccggacaatggcaattacggtcgtcagaccctg
acccatgaaatcggccacacccttggcctgtctcacccaggtgactacaacgcgggcgag
ggcaatccgagctacaaggacgccacttacgcagaagatacccgtggctacagcgtcatg
agttactggagtgagtccaacaccgaccagaacttcgtcaagggcggtgctccgtcgtac
tcttcggcaccgttgctggatgacatcactgccgttcagcagctctatggcgcgaacatg
agcacccgtgccggtgatacggtctatgggttcaactccactgccgggcgcgatttctac
agcgccacctccgcctcgtccaaggtggtgttctcggtgtgggatggcgggggcaaggat
accctcgacttctcaggcttcacccagaaccagaagatcaacctcaatgccgcctcgttc
tcggatgtcggtggcatggtgggcaacgtttcgatcgccaagggtgtggtggttgaaaac
gcgctgggcggttcgggcaatgacctgttgatcggcaatgctgccgccaacgacctcaag
ggtggtgccggcaacgacatcatctacggtggtggcggcgccgacagcctgaccggtggt
gcaggtgccgacatcttcgtgtttggcgccagctctgattccaaccgtgcaggccaggat
acgattcgtgatttcgtcagcggtcaggacaagatcgacgtgtcggccatttccacgctg
agcgcgctgcagttcgtcaacgcgttcagcggccacgctggcgaggcgatcctcaactat
aaccagagcagcaatctgggcagtctggcgatcgacttcaccggtcagggcattggcgat
tttctggtcggtactgtaggtcaagcattggctactgatatcgtggtttaa

DBGET integrated database retrieval system