KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3196Help
Entry
Psyr_3196         CDS       T00246                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:psb01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:psb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3825917..3827242
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWTNVTRTYSAADVVRLRGSVQPEHTFARLGADKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKAPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDKPFVTGERTHEGFYKVRAGLDQAIARGLAYAPYADLIWCETAR
PDLDEARRFAEAIKKQYPDQLLSYNCSPSFNWKKNLDDATIARFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGVSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacaacaaatagcggctctcgagaaagactgggctgaaaatccg
cgctggacaaacgtgacccgtacttactccgctgcagatgtggtccgcctgcgcggctca
gttcaacccgaacacacctttgcacgactgggtgcagacaagctgtggaatctggtgacc
cagggtgccaaaccgtccttccggccggacaaggatttcgtcaattgcatgggcgccctc
accggtggccaggccgtgcagcaggtcaaggccggcattcaggccatctacctgtccggc
tggcaggtcgctgccgacaacaactctgccgagtccatgtacccggatcagtcgctgtac
ccggtcgactcggtgccgaccgtggtcaagcgcatcaacaactcgttccgccgtgccgac
cagatccagtggaaagccggcaaggcgccgggtgacgaaggctacatcgactacttcgct
ccgatcgtcgcagatgcggaagccggattcggcggcgtactcaatgcctatgagctgatg
aaaagcatgatcgaagccggcgccgccggggtgcacttcgaagatcaactggcgtcggtg
aagaaatgcggccacatgggcggcaaggtactggtcccgactcaggaagccatacagaaa
ctggtcgctgcacgcctggccgccgacgtggccggtgtaccgaccatcattctggcccgg
actgacgccaacgctgccgacttgctgacatccgattgcgatccgtacgacaagccattc
gtgaccggcgaacgaacccatgaggggttctacaaggttcgcgccggcctcgatcaggcc
atcgcgcgcggcctggcgtacgcgccttacgctgatctgatctggtgcgaaacagccagg
ccggacctcgacgaggcacgccgcttcgccgaagcgatcaaaaagcaataccccgatcag
ttgctgtcctacaactgctcgccgtccttcaactggaagaaaaacctcgacgacgcaacc
atcgccaggtttcagcgcgagctctcggccatgggctacaagcaccagttcatcaccctg
gcgggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaat
gacatgaccgcctatgtgaagctgcaggaacaggagttcgccgacgctgccaagggctac
accttcgtggctcaccagcaggaagtgggcacgggctatttcgatgacatgacgaccgtg
atccagggtggcgtatcgtcggtaaccgcactgaccggctcaaccgaagaagagcaattc
cactga

DBGET integrated database retrieval system