KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3196Help
Entry
Psyr_3196         CDS       T00246                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00630  Glyoxylate and dicarboxylate metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psyr_3196
Enzymes [BR:psb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Psyr_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 3368718
NCBI-ProteinID: YP_236266
UniProt: Q4ZRJ4
Position
3825917..3827242
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWTNVTRTYSAADVVRLRGSVQPEHTFARLGADKLWNLVT
QGAKPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKAPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDKPFVTGERTHEGFYKVRAGLDQAIARGLAYAPYADLIWCETAR
PDLDEARRFAEAIKKQYPDQLLSYNCSPSFNWKKNLDDATIARFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGVSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacaacaaatagcggctctcgagaaagactgggctgaaaatccg
cgctggacaaacgtgacccgtacttactccgctgcagatgtggtccgcctgcgcggctca
gttcaacccgaacacacctttgcacgactgggtgcagacaagctgtggaatctggtgacc
cagggtgccaaaccgtccttccggccggacaaggatttcgtcaattgcatgggcgccctc
accggtggccaggccgtgcagcaggtcaaggccggcattcaggccatctacctgtccggc
tggcaggtcgctgccgacaacaactctgccgagtccatgtacccggatcagtcgctgtac
ccggtcgactcggtgccgaccgtggtcaagcgcatcaacaactcgttccgccgtgccgac
cagatccagtggaaagccggcaaggcgccgggtgacgaaggctacatcgactacttcgct
ccgatcgtcgcagatgcggaagccggattcggcggcgtactcaatgcctatgagctgatg
aaaagcatgatcgaagccggcgccgccggggtgcacttcgaagatcaactggcgtcggtg
aagaaatgcggccacatgggcggcaaggtactggtcccgactcaggaagccatacagaaa
ctggtcgctgcacgcctggccgccgacgtggccggtgtaccgaccatcattctggcccgg
actgacgccaacgctgccgacttgctgacatccgattgcgatccgtacgacaagccattc
gtgaccggcgaacgaacccatgaggggttctacaaggttcgcgccggcctcgatcaggcc
atcgcgcgcggcctggcgtacgcgccttacgctgatctgatctggtgcgaaacagccagg
ccggacctcgacgaggcacgccgcttcgccgaagcgatcaaaaagcaataccccgatcag
ttgctgtcctacaactgctcgccgtccttcaactggaagaaaaacctcgacgacgcaacc
atcgccaggtttcagcgcgagctctcggccatgggctacaagcaccagttcatcaccctg
gcgggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaat
gacatgaccgcctatgtgaagctgcaggaacaggagttcgccgacgctgccaagggctac
accttcgtggctcaccagcaggaagtgggcacgggctatttcgatgacatgacgaccgtg
atccagggtggcgtatcgtcggtaaccgcactgaccggctcaaccgaagaagagcaattc
cactga

DBGET integrated database retrieval system