KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3281Help
Entry
Psyr_3281         CDS       T00246                                 

Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00520  Amino sugar and nucleotide sugar metabolism
psb01100  Metabolic pathways
psb01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psyr_3281
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Psyr_3281
Enzymes [BR:psb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Psyr_3281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 3368808
NCBI-ProteinID: YP_236351
UniProt: Q4ZRA9
Position
complement(3928376..3929386)
Genome map
AA seq 336 aa AA seqDB search
MSSGLQGSLMVDVAGTWLTSEDRQFLRQPEVGGLIIFARNIEHPRQVRELSAAIRAVRPD
LLLAVDQEGGRVQRLREGFVRLPPMRAIADKPDAELLAEHCGWLMATEVLAVGLDLSFAP
VLDLDYQRSAVVGTRSFEGDPQRAALLAGAFIRGMNATGMAATGKHFPGHGWAEADSHVA
IPNDERSLEEIRANDLVPFARLSQQLAAVMPAHVIYPKVDSQPAGFSRRWLQDILRDELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALGAAQRLKVKPS
PRIARMRGLASASTDYRQHPRWQAALQALRAAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagttctggcctgcaaggctccctgatggtcgatgtcgccggcacctggctgaccagc
gaagaccgtcagtttttgcgtcagcccgaagtgggcggtttgatcatctttgcccgaaac
atcgagcatccccgtcaggttcgtgaattgagcgccgcgattcgtgccgtgcgcccggac
ctgctgctggccgtcgatcaggagggcggcagggtacagcgcctgcgtgagggcttcgta
cgcctgccgccgatgcgcgccatcgccgacaagcctgacgccgagcttctggctgaacac
tgtggctggctgatggcgaccgaagtgctggcggtcggactggacctgagcttcgccccg
gtgctggacctcgactaccagcgcagcgctgtggtcggcacgcgttcgttcgaaggcgat
ccgcagcgcgcggcgttgctggcaggggcgttcattcgtgggatgaacgccaccggtatg
gctgccaccggcaagcattttcccggtcacggctgggctgaagccgattctcatgtggct
atcccgaatgacgagcgcagcctggaagagatccgcgccaatgatctggtgccgtttgca
cgcctgagtcagcagctggctgcagtgatgccggcgcatgtcatctacccgaaagtcgat
tcgcagcccgctggcttttcaaggcgctggctgcaggacattctgcgcgacgaactgcaa
tttgacggtgttattttcagtgacgacctgtcgatggccggcgctcatgtcgtcggggat
gcggccagccgtatcgaggcagcgctgacagccggatgcgacatgggcctggtgtgcaac
gaccgcgcggccgcagagcttgcgctgggcgctgcgcagcgcctgaaggtcaagccttcg
ccacgtatcgcccgtatgcgcggtctggcgtcggccagtaccgactatcggcaacacccg
cgctggcaggccgcgctccaggctctgcgcgctgctcaactgatcgattaa

DBGET integrated database retrieval system