KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3396Help
Entry
Psyr_3396         CDS       T00246                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:psb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Psyr_3396 (recR)
DNA repair and recombination proteins [BR:psb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Psyr_3396 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Psyr_3396 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Toprim_2 HHH
Motif
Other DBs
NCBI-GeneID: 3368923
NCBI-ProteinID: YP_236466
UniProt: Q4ZQZ4
Position
complement(4053568..4054170)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDAFRVLPGVGQKTAQRMALQLLERDRSGGSRLAQALGQAMDGVGHCRSC
RTLTEEELCPQCADPRRDDTLLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMERISQQGTFTEVILATNPTVEGEATAHYIAQLLHDKGLVASRIAHGVPLGGEL
DLVDGGTLAHSFAGRKPIAM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccagttgatcgatgccttccgcgtgctgccgggcgtc
ggtcagaaaaccgctcagcgcatggcgttgcagttgctggagcgcgaccgcagcggcggt
tcgcggctggcgcaggcactggggcaggcgatggacggcgtgggtcactgccgctcgtgc
cgcacgctgaccgaagaggagctctgcccgcaatgcgcagacccgcggcgtgatgacacg
ctgctgtgtgtggtcgaaggcccgacggatgtctatgcggtggagcagactggctaccgc
ggtcgttacttcgtgctcaagggccatctgtcgccactcgacggcctgggaccggaggcc
atcggcattccgcaattgatggagcgcatcagccagcagggcacctttaccgaggtgatc
ctcgccaccaatccgaccgtggaaggcgaagcgacggcgcattacatcgctcaactgctc
cacgacaagggcctggtcgcgtcgcgcattgctcacggcgttccgttgggtggcgagctg
gacctggtcgacggtggcacgctggcgcattcgtttgcagggcgcaaaccgattgcaatg
tga

DBGET integrated database retrieval system