KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3905Help
Entry
Psyr_3905         CDS       T00246                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Psyr_3905 (glpK)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    Psyr_3905 (glpK)
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Psyr_3905 (glpK)
Exosome [BR:psb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyr_3905 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4645937..4647442
Genome map
AA seq 501 aa AA seqDB search
MTDTQNKNYIIALDQGTTSSRAIIFDRDANVVSTAQSEFVQHYPQAGWVEHDPMEIFATQ
TACMTKALAQADLHHNQIAAIGITNQRETTVIWERDTGRPIYNAIVWQCRRSTEICQQLK
RDGLEEYIKDTTGLVIDPYFSGSKVKWILDNVEGSRERARKGELMFGTIDTWLIWKFTGG
KVHVTDYTNASRTMLFNIHTLEWDQRMLDVLDIPREMLPEVKASSEVYGHSKSGIPIAGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGKKAVKSAHGMLTTIGCGPRGEVAYAL
EGAVFNGGSTVQWLRDELKLINDALDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDSGERLKSLRVDGGAVANNFLMQFQ
ADILGTHVERPQMRETTALGAAFLAGLAIGFWSSLDELRNKAVIERVFEPSCEEAHREKL
YAGWQKAVARTRDWEPHENEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacacagaacaagaactacatcattgctcttgaccagggcaccaccagctcg
cgcgccatcatcttcgaccgcgacgccaacgtggtgagcactgcccaaagcgaattcgtt
cagcattacccgcaggcaggctgggtcgaacacgacccgatggaaatcttcgccactcag
accgcgtgcatgaccaaggcgctggcgcaggccgatctgcaccacaaccagatcgccgcg
atcggtatcaccaatcagcgtgaaaccaccgtcatctgggaacgcgacaccggccgcccg
atctacaacgccatcgtctggcagtgccgccgcagcaccgagatctgccagcaactcaag
cgcgatggccttgaggagtacatcaaggacaccacaggcctggtgattgacccgtacttc
tccggctccaaggtcaagtggatcctggacaacgtcgaaggcagccgtgagcgcgcccgc
aaaggcgagctgatgttcggcaccatcgatacctggctgatctggaaattcaccggtggc
aaggttcacgtcaccgactacaccaatgcctcgcggaccatgctgttcaacatccatacg
ctggaatgggatcagcgcatgctcgacgtgctggatatcccgcgcgagatgctgccggag
gtcaaagcctcctccgaagtttacggccacagcaagagcggcatcccgatcgccggtatc
gcaggcgaccagcaggcggcgttgttcggccagatgtgtgtcgaacccggccaggccaag
aacacctatggcactggctgcttcctgctgatgaacaccggcaagaaagccgtgaaatcg
gcgcacggcatgctcaccaccatcggctgtggcccgcgtggcgaagtggcctatgcgctg
gaaggcgcggtcttcaacggtggctcgacggtgcagtggctgcgcgacgaactcaaactc
atcaacgacgcgctggacaccgaatacttcgccggcaaggtcaaggacagcaacggcgtg
tacctggtgccggcgttcacgggcctgggcgcaccttactgggacccgtacgcacgaggc
gcattgttcggcctgacccgtggcgtgaaagtcgatcacatcatccgtgcagcgctggaa
tccatcgcttatcagacccgcgacgtactcgatgccatgcaacaggactccggcgaacgc
ctcaagtcgttgcgtgtggacggcggtgccgtggccaacaacttcctgatgcagttccag
gcagacatcctcggcacccacgtcgagcgcccgcaaatgcgtgaaactacggcactgggt
gcagccttcctggccggtctggcgattggtttctggagcagcctggacgagttgcgtaac
aaggccgtgatcgagcgtgtgttcgagccgtcctgtgaagaagcgcatcgcgaaaaactt
tacgcaggctggcagaaagcagtcgcgcgcactcgtgactgggaaccgcacgaaaacgaa
gagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system