KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4171Help
Entry
Psyr_4171         CDS       T00246                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psyr_4171
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Psyr_4171
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyr_4171
Enzymes [BR:psb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Psyr_4171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4960367..4961950)
Genome map
AA seq 527 aa AA seqDB search
MSQFDLKRRRVIQAVGTVGAGLLLPGVAPAVIASVQDRPKMMDGVQSGDVFGDKAIVWSR
SDRPSRMVVEWDTRSMFTQPRRVVSALADQRSDFTARVELSGLPVDQAIFYRVSFEDAQS
GVVSEPWFGHLRSTPQQRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHS
GDTIYADSPVPEQLTTEGGRVWRNITTEAKSKVAETLDEYRGNYRYNLMDENLRRFNAEV
PQIWQWDDHEVTNNWSPSKQLDDRYKVKDIGLLSSRARQAYLEYAPLRLQEADNGGRIYR
KIPYGPMLDVFVLDMRSYRAGNDANLADKPGATTAFMGREQLDWLKRELNASRAQWKVIA
ADMPIGLGVPDGEVSPGVPRWEAIANGNDGPALGRELEVAELLAYLRAQKIRDCVWLTAD
VHYCAAHHYQPDLAVFQDFDPFWEFVAGPLNAGSYGPNVLDKTFGPELVFQKAPPAQNTS
PFAGFQFFGEVNIDGQTGEMTVALRDLDGVSVFERKLQPVKEVSRIV
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagttcgatctcaagcgtcgccgtgtcatccaggccgtcggaacggtaggtgcc
ggtctgctgttaccgggtgttgcaccggcggtcatcgcctcggtgcaggatcgtccgaag
atgatggatggcgtgcagtccggcgatgtgttcggcgacaaggcgatcgtctggagccgc
agcgaccggccttcgcgcatggtcgtcgagtgggacacgcgcagcatgttcacccagcca
cgccgcgtggtgtcggcgctggccgatcagcgtagcgactttaccgcgcgggtcgagttg
agcgggctgcctgtcgatcaggcgattttctaccgggtgtctttcgaggatgcgcagagc
ggtgtcgtcagcgagccgtggttcggtcatttgcgcagcacgccgcagcagcgccgcgac
atccgcttcgtctggagcggcgacacggtggggcagggctttggcatcaaccccgatatt
ggcggcatgcgtatctatgaagccatgcgtttgcgcttgccggacttttttatccacagc
ggtgacaccatctacgccgacagcccggtgccggagcagctcaccacggagggcgggcgc
gtctggcgcaacatcaccaccgaggcgaagagcaaggtggcggagaccctcgacgaatac
cggggcaattaccgctacaacctgatggatgaaaacctgcgccgcttcaacgccgaagtg
ccgcagatctggcagtgggacgatcacgaagtgaccaacaactggtcacccagcaaacag
ctcgatgatcgctacaaggtcaaggacatcggcctgctgtcctcgcgtgcccgccaggct
tatctggaatacgcgccgctgcgcttgcaggaagccgacaatggcgggcgcatttatcgc
aagatcccctacggtccgatgctcgacgttttcgtcctcgatatgcgcagctaccgcgcc
ggcaacgatgccaacctggccgacaagccgggtgcgaccaccgcattcatgggccgtgag
caactggactggctcaagcgtgagctcaatgcatcgcgcgcgcagtggaaagtcatcgcg
gcggacatgcccattggcctgggcgtgccggatggcgaggtcagccccggcgtaccgcgt
tgggaggccatcgccaacggcaatgacggtccggcgttggggcgtgagttggaggtcgcc
gaattgctggcgtacctgcgcgcgcagaagattcgcgattgcgtctggctgaccgccgac
gtgcattactgcgcggcgcatcattaccagccggacctggccgtgtttcaggacttcgac
ccgttctgggagttcgtcgccgggccattgaacgccggtagctatggtcccaacgtgctg
gacaagacctttggtcccgagctggtgttccagaaagcgccacctgcgcagaacacctcg
ccgtttgcgggttttcagttttttggcgaagtgaatatcgacgggcagaccggtgagatg
accgtggcgctgcgcgatctggacggggtctcggtcttcgagcgcaagctccagcctgtg
aaggaagtcagccgcatcgtctga

DBGET integrated database retrieval system