KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4184Help
Entry
Psyr_4184         CDS       T00246                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyr_4184 (tpiA)
   01230 Biosynthesis of amino acids
    Psyr_4184 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_4184 (tpiA)
   00051 Fructose and mannose metabolism
    Psyr_4184 (tpiA)
   00562 Inositol phosphate metabolism
    Psyr_4184 (tpiA)
Enzymes [BR:psb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Psyr_4184 (tpiA)
Exosome [BR:psb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Psyr_4184 (tpiA)
  Exosomal proteins of bladder cancer cells
   Psyr_4184 (tpiA)
  Exosomal proteins of melanoma cells
   Psyr_4184 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4976938..4977693)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELIEGLCKQSLPGSVDIAVMPASLFTCQVVDGLKATSIIV
GAQDAAIQAEQGALTGEVASSQLADAGCKLVLVGHSERRQLIGEQDDVLNKKFAAIQAKG
LTPVLCVGETLEERKAGQTLEVVGRQLDSVIAEFGVNALVNAVIAYEPVWAIGTGLTASP
QEAQEVHAAIRAQLAKENAEVAQGVRLLYGGSVKAANAVELFSMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcccaatggtagctggtaactggaaaatgcacggtacccgcgccagcgtcgct
gagctgatcgagggtttgtgcaagcagtcgttgccaggcagcgtcgatatcgccgtgatg
cctgccagtctgtttacctgtcaggtggtcgatgggctcaaggccacgtcgatcatcgtc
ggtgcgcaggacgcagccattcaggctgagcagggcgcgctgacgggtgaagttgcatct
agccagctggctgatgcaggttgcaagctggtacttgtcgggcactccgagcgtcgtcag
ttgattggcgaacaggatgatgttctgaacaaaaagtttgcggcaatccaggcgaaaggt
ctgacacctgtgctttgcgtaggtgaaaccctggaagagcgcaaggcggggcaaacgctt
gaagtggtagggcgtcagctggacagtgttatcgccgagtttggcgtcaatgcactggtc
aacgccgtcattgcctacgagccggtctgggccattggcaccggattgactgcttcgcct
caggaagcgcaggaagtgcacgcagccatccgtgcgcaactggcaaaagagaatgccgaa
gtcgcacaaggcgtgcgacttctctatggcggcagcgtgaaggcggccaatgcggtcgag
ctcttcagcatgccggatatcgatggggggctcattggtggagcttccctgaatgcagat
gagttcggtgcgatctgtcgcgccgcgggaaactga

DBGET integrated database retrieval system