KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4247Help
Entry
Psyr_4247         CDS       T00246                                 

Definition
ornithine decarboxylase (EC:4.1.1.17)
Orthology
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Psyr_4247
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psyr_4247
Enzymes [BR:psb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     Psyr_4247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5061734..5062897)
Genome map
AA seq 387 aa AA seqDB search
MPINVEDYYSAETFKKMKAFADKQETPFVVIDTDIISKAYDDLRAGFEFAKVYYAVKANP
AVEVINLLKEKGSSFDIASIYELDKVLSCGVGPERMSYGNTIKKSKDIRYFYEKGVRLFA
TDSEADLRNIAKAAPGAKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVP
YGISFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIVLKLINMGGGFPANYITRTNSLE
TYAEEIIRFLKEDFGDDLPEIILEPGRSLISNAGILVSEVVLVARKSRTAVERWVYTDVG
KFSGLIETMDEAIKFPIWTEKKGEMEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRMY
WLSTGAYTTSYSAVEFNGFPPLKSFYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatgtcgaagactactactcagccgaaaccttcaagaaaatgaaggcgttc
gctgacaagcaagaaaccccgttcgtggtcattgatactgacatcatcagcaaggcatat
gacgacctgcgtgcgggcttcgaattcgccaaggtttactacgcggtcaaggccaaccct
gccgttgaagtcatcaatctgctcaaggaaaagggttcgagcttcgacatcgcctcgatc
tacgagctggacaaggtcctgagctgcggcgttggtccggagcgcatgagctacggcaac
accatcaagaaatccaaggacattcgttacttctacgagaagggcgtgcgtctgttcgcc
accgactccgaagccgacctgcgcaacattgccaaggctgcaccgggcgcgaaagtctat
gtgcgcatcctgaccgaagggtcgaccaccgccgactggcctctgtcgcgcaaattcggc
tgccagaccgacatggccatggacctgctgattcttgcccgcgatctgggtctggtgcct
tacggcatctcgttccacgtcggctcgcagcagcgcgacatcagcgtctgggatgctgcc
atcgccaaggtcaaagtgatcttcgagcgtctgaaagaagaagacggcatcgttctcaag
ctgatcaacatgggtggcggcttcccggccaactacatcacccgcaccaacagcctggaa
acctacgctgaagagatcatccgcttcctgaaggaagacttcggtgatgacctgccggaa
atcattctcgagccaggccgttcgttgatctccaacgccggtattctggtcagcgaagtg
gtactggttgcccgcaagtcgcgtaccgcggtcgagcgttgggtatacaccgatgtgggc
aagttctccggcctgatcgaaaccatggacgaagccatcaagtttccgatctggaccgaa
aagaaaggcgaaatggaagaagtggtcatcgccggtcctacctgcgacagcgccgacatc
atgtacgaaaactacaagtacggtctgcccctcaacctggccatcggtgaccgcatgtac
tggttgtccaccggtgcctacaccaccagttacagcgcagtggaattcaatggcttcccg
ccgctgaagtcgttctacctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system