KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4247Help
Entry
Psyr_4247         CDS       T00246                                 

Definition
ornithine decarboxylase (EC:4.1.1.17)
Orthology
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:psb00330]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psb00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5061734..5062897)
Genome map
AA seq 387 aa AA seqDB search
MPINVEDYYSAETFKKMKAFADKQETPFVVIDTDIISKAYDDLRAGFEFAKVYYAVKANP
AVEVINLLKEKGSSFDIASIYELDKVLSCGVGPERMSYGNTIKKSKDIRYFYEKGVRLFA
TDSEADLRNIAKAAPGAKVYVRILTEGSTTADWPLSRKFGCQTDMAMDLLILARDLGLVP
YGISFHVGSQQRDISVWDAAIAKVKVIFERLKEEDGIVLKLINMGGGFPANYITRTNSLE
TYAEEIIRFLKEDFGDDLPEIILEPGRSLISNAGILVSEVVLVARKSRTAVERWVYTDVG
KFSGLIETMDEAIKFPIWTEKKGEMEEVVIAGPTCDSADIMYENYKYGLPLNLAIGDRMY
WLSTGAYTTSYSAVEFNGFPPLKSFYL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatgtcgaagactactactcagccgaaaccttcaagaaaatgaaggcgttc
gctgacaagcaagaaaccccgttcgtggtcattgatactgacatcatcagcaaggcatat
gacgacctgcgtgcgggcttcgaattcgccaaggtttactacgcggtcaaggccaaccct
gccgttgaagtcatcaatctgctcaaggaaaagggttcgagcttcgacatcgcctcgatc
tacgagctggacaaggtcctgagctgcggcgttggtccggagcgcatgagctacggcaac
accatcaagaaatccaaggacattcgttacttctacgagaagggcgtgcgtctgttcgcc
accgactccgaagccgacctgcgcaacattgccaaggctgcaccgggcgcgaaagtctat
gtgcgcatcctgaccgaagggtcgaccaccgccgactggcctctgtcgcgcaaattcggc
tgccagaccgacatggccatggacctgctgattcttgcccgcgatctgggtctggtgcct
tacggcatctcgttccacgtcggctcgcagcagcgcgacatcagcgtctgggatgctgcc
atcgccaaggtcaaagtgatcttcgagcgtctgaaagaagaagacggcatcgttctcaag
ctgatcaacatgggtggcggcttcccggccaactacatcacccgcaccaacagcctggaa
acctacgctgaagagatcatccgcttcctgaaggaagacttcggtgatgacctgccggaa
atcattctcgagccaggccgttcgttgatctccaacgccggtattctggtcagcgaagtg
gtactggttgcccgcaagtcgcgtaccgcggtcgagcgttgggtatacaccgatgtgggc
aagttctccggcctgatcgaaaccatggacgaagccatcaagtttccgatctggaccgaa
aagaaaggcgaaatggaagaagtggtcatcgccggtcctacctgcgacagcgccgacatc
atgtacgaaaactacaagtacggtctgcccctcaacctggccatcggtgaccgcatgtac
tggttgtccaccggtgcctacaccaccagttacagcgcagtggaattcaatggcttcccg
ccgctgaagtcgttctacctgtaa

DBGET integrated database retrieval system