KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4487Help
Entry
Psyr_4487         CDS       T00246                                 

Definition
carbohydrate kinase PfkB
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psyr_4487
Enzymes [BR:psb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Psyr_4487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5348764..5349690
Genome map
AA seq 308 aa AA seqDB search
MSKIAVIGSNMVDLITYIERMPAQGETLEAPRFAMGCGGKGANQAAAAALLGADVLMLSK
VGDDAFADTTLANFQRLGIDTRFVERVPGVSSGVAPIFVQENSHNSILIVKGANAHLSPA
DIDRAEAQLRDCALIVLQLEVELATVYHAIAFAHRHAIPVLLNPAPALAGLSREHLAQLD
FLIPNESELALISGQPVTCAEEAAQAARQLVALGVRHVIVTLGEQGALYVGAEGEWQVPG
VKVQARDTTGAGDAFIGCFARHWSQDGNIRQAMHQAVAYSACSVTGLGTQSSYPDASTFA
RFLDASAN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattgcagtcatcggcagcaacatggtcgacctgatcacttacatcgaacgc
atgcccgcccagggcgaaacgctcgaggcaccgcgttttgccatggggtgcggcggcaag
ggcgccaatcaggccgccgccgcggcgctgctgggcgccgacgtgctgatgctcagcaag
gtcggcgacgatgcgttcgccgataccaccctggccaattttcagcgactgggcattgat
acgcgcttcgtcgaacgggtaccgggcgtgtcgagcggcgtggcaccgatcttcgtccag
gagaactcccataacagcatccttatcgtcaaaggcgccaatgcccacctgagcccggcc
gatatcgaccgcgccgaggcgcaactgcgcgattgcgctttgattgtgctgcaactggaa
gtcgagctggcgaccgtctaccacgccatcgccttcgctcaccggcacgcaatcccggtg
ctgctcaatccggccccagccttggccggcctgagccgcgagcacctcgcgcagctggac
ttcctgatccccaacgagagcgagctggccctgatcagcggccagccggtgacgtgcgcc
gaggaagcggctcaggctgcacgccaattggtcgcgctgggcgtacgccacgtcatcgtc
accctcggcgaacaaggggcgctgtacgtcggcgccgaaggcgagtggcaggtgccaggg
gtcaaggttcaggcgcgtgacaccaccggtgccggtgacgccttcattggctgcttcgcc
cggcactggagccaggacggaaatattcgccaagccatgcaccaggcggtggcctactcc
gcctgctcggtcaccggcctcggcacgcaatcttcttaccccgatgcgtccacgtttgca
cgattcctcgatgcatcggccaactga

DBGET integrated database retrieval system