KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4700Help
Entry
Psyr_4700         CDS       T00246                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyr_4700
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psyr_4700
   00630 Glyoxylate and dicarboxylate metabolism
    Psyr_4700
Enzymes [BR:psb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psyr_4700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5569094..5571271
Genome map
AA seq 725 aa AA seqDB search
MTEYVQVGDLQVARVLFDFVQNEATPGTGVDATAFWAGADKLIHDLAPKNKALLAKRDEL
QAKIDAWHQSHAGQAHDASAYKAFLQEIGYLLPEAADFQITTQNVDEEIATMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEEGGAQKGKGYNKVRGDKVIAFARAFLDQAA
PLSAGSHADSTAYKLIDGKLVVSLKGGSNTGLHDDAQLIGFQGDALAPFALLLKHNGLHF
ELQIDAASPVGQTDPAGVKDILMEAALTTIMDCEDSIAAVDADDKVVVYRNWLGLMKGDL
AESVSKGGETFTRTMNPDRVYTTPEGGEVTLHGRSLLFIRNVGHLMTIDAILDKHGNEVP
EGILDGLLTSLAALHNLKGNTSRSNSRSGSMYIVKPKMHGPQEAAFTNELFERIEQVLGL
PRNTLKVGIMDEERRTTVNLKACIQAASERVVFINTGFLDRTGDEIHTSMEAGPVVRKAQ
MKAEKWITAYENSNVDIGLKCGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAQREQASVDDILTIALAPNTDWTPEEIQNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHMANWLRHGVVSETQVLESL
KRMAPVVDRQNANDPLYRPLAPDFDSNIAFQAAVELVIEGTRQPNGYTEPVLHRRRREFK
AINGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacgttcaagtcggtgacctgcaagtcgccagagtcctgttcgacttcgtg
cagaacgaagccacccccggaaccggcgtcgatgccactgcgttctgggccggtgcggac
aaactgatccacgaccttgcgccaaagaacaaggcactgctcgccaaacgtgatgagtta
caggcgaaaatcgacgcctggcaccagtcgcatgccgggcaggctcacgacgcctcggcc
tacaaagccttccttcaggagatcggctacctgctgccagaagcggcggatttccagatc
accacgcaaaacgtcgatgaagaaatcgccaccatggctggcccgcaactggtcgtgccg
gtgatgaacgcccggtttgcgctcaatgcgtcgaatgcccgttggggttcgctgtatgac
gcgctctacggcaccgacgccatcagcgaagaaggcggcgcgcaaaagggcaagggctat
aacaaggtgcgtggcgacaaggtgattgctttcgctcgtgcctttctcgatcaggcagcg
cctctgtcagcaggttcacatgccgactcgacagcttataagctgatcgacggcaagctg
gtcgtcagtctcaagggtggcagcaataccggcctgcacgatgacgcccaactgatcggt
tttcaaggcgatgccctggcgccgtttgccttgctgctcaagcacaacggtctgcacttc
gaactgcagatcgacgccgccagcccggtcgggcagaccgatccggcgggcgtgaaagac
atcctcatggaagccgcgctgaccaccatcatggactgcgaagattccattgccgctgtg
gacgccgacgacaaagtggtcgtctaccgcaactggctgggcctgatgaagggcgacctg
gccgagtcggtgtccaagggcggtgaaacctttacccgcaccatgaacccggaccgcgtc
tacaccacgccagagggcggcgaagtcaccctgcacggtcgctcgctgctgttcattcgc
aacgtgggccacttgatgaccatcgatgcgatactcgacaagcatggcaacgaagtgcca
gaaggcattctcgacggcctgctgaccagtctcgccgccctccacaacctcaagggcaac
acctcgcgcagcaacagccgcagcggctcgatgtacatcgtcaaaccgaagatgcacggt
ccgcaggaagctgcattcaccaacgaactgttcgagcgtatcgagcaggtactgggcttg
ccgcgtaacaccttgaaggtcgggatcatggacgaggagcgccgtaccacggtcaacctc
aaggcctgcattcaggccgccagcgagcgtgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgaaatccatacctccatggaagcgggaccggtggtacgcaaggcacag
atgaaagccgagaagtggatcactgcctacgagaactccaacgtcgacatcggtctgaaa
tgcggcctgcaaggtcgcgcacagatcggcaaaggcatgtgggccatgccggacctgatg
gccgccatgctggagcagaaaatcgctcatccactggctggcgccaacaccgcctgggtc
ccgtcacctacggcggctgcgctgcacgcgctgcattaccacaaggtcgacgtgttcgcc
cggcaggccgaactggcgcagcgcgagcaagcctcggtggatgacattctgaccattgcg
ctggcaccgaacacggactggacgccggaagaaatccagaacgaactggacaacaacgcg
cagggcattcttggctacgtagtgcgctggatcgatcagggcgtggggtgttcgaaagtg
ccggacatcaatgacatcggcctgatggaagaccgcgctacgctgcgcatctccagccag
cacatggccaactggctgcgtcatggtgtcgtcagcgaaactcaggttctggaaagcctc
aagcgcatggccccggtggtggatcgccagaacgccaacgacccgctgtatcgcccgctg
gcacccgacttcgacagcaacatcgccttccaggcggcggtcgaactggtcatcgaaggt
acccggcagcccaacggctacaccgagccggtattgcaccgccgccgtcgggagttcaag
gccatcaacggcctgtaa

DBGET integrated database retrieval system