KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4718Help
Entry
Psyr_4718         CDS       T00246                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase superfamily protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00625  Chloroalkane and chloroalkene degradation
psb00680  Methane metabolism
psb01100  Metabolic pathways
psb01120  Microbial metabolism in diverse environments
psb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Psyr_4718
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyr_4718
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Psyr_4718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 3370268
NCBI-ProteinID: YP_237783
UniProt: Q4ZM77
Position
5591208..5592407
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSCKEQNTGVCLTVNPARP
GGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLVHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVISLDDAPRGYGEFDSGVPKKFVIDPHGLFGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgcggtgtagtgtatctcggcgctggcaaggtcgaagtgcaatcaatt
cctttcccgaaaatggaagatccacgcggcaagcgcatcgaacacggcgtgatcctgcgc
gtggtctccaccaacatctgcggctcggaccagcacatggtacgcggccgcaccacggcg
caaaccgggctggtactcggtcatgaaatcactggcgaggtgctggaagccggtcgtgac
gtggaacatctgaaagtcggtgacctggtttctgtgccattcaacgtggcgtgcggtcgc
tgccgcagttgcaaggaacagaacaccggcgtctgcctgacggtcaaccctgcgcgcccc
ggtggtgcctatggttatgtcgacatgggcgattgggtcggcggccaggctgaatacgtg
ctggtgccttacgccgacttcaacctgctcaaacttccggaccgcgatgcggcgatggaa
aaaattcgcgacctgacctgcctgtccgacatcctgcccaccggctaccacggcgcagtg
actgccggggtggggccgggcagcacagtctacgttgcaggcgctggcccggtcggcctg
gctgcggcggcgtcagcacgcttgctgggcgctgccgtggtgatcgtcggcgacgtgaac
ccgacgcgtctggttcacgccaaggcccagggcttcgaaattgccgacctgtcccaggac
actcccttgcacgagcagatcgctgccctgctcggcgaacccgaagtggattgcgccatc
gacgccgtaggcttcgaagcacgcggtcacggtcatgctggcgctcaggccgaagcaccc
gccaccgtgctcaactcgttgatgggcgtagtgcgcgtcgccggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggagccgttgacgccgccgccaaaatgggcagcctg
agcattcgcttcggcctgggctgggccaaatcccacagcttccacaccggccagaccccg
gtcatgaaatacaaccgccaactgatgcaggcgatcatgtgggaccgcatcaagatcgcc
gacatagtgggtgtcgaggtgatcagtctggatgatgctccgcggggttatggcgagttt
gattcgggcgtgccgaagaagtttgtgattgatccgcatgggttgtttggtgctgcgtaa

DBGET integrated database retrieval system