KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4718Help
Entry
Psyr_4718         CDS       T00246                                 

Definition
zinc-containing alcohol dehydrogenase superfamily protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psyr_4718
  Energy metabolism
   00680 Methane metabolism
    Psyr_4718
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyr_4718
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Psyr_4718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5591208..5592407
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSCKEQNTGVCLTVNPARP
GGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLVHAKAQGFEIADLSQD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVISLDDAPRGYGEFDSGVPKKFVIDPHGLFGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgcggtgtagtgtatctcggcgctggcaaggtcgaagtgcaatcaatt
cctttcccgaaaatggaagatccacgcggcaagcgcatcgaacacggcgtgatcctgcgc
gtggtctccaccaacatctgcggctcggaccagcacatggtacgcggccgcaccacggcg
caaaccgggctggtactcggtcatgaaatcactggcgaggtgctggaagccggtcgtgac
gtggaacatctgaaagtcggtgacctggtttctgtgccattcaacgtggcgtgcggtcgc
tgccgcagttgcaaggaacagaacaccggcgtctgcctgacggtcaaccctgcgcgcccc
ggtggtgcctatggttatgtcgacatgggcgattgggtcggcggccaggctgaatacgtg
ctggtgccttacgccgacttcaacctgctcaaacttccggaccgcgatgcggcgatggaa
aaaattcgcgacctgacctgcctgtccgacatcctgcccaccggctaccacggcgcagtg
actgccggggtggggccgggcagcacagtctacgttgcaggcgctggcccggtcggcctg
gctgcggcggcgtcagcacgcttgctgggcgctgccgtggtgatcgtcggcgacgtgaac
ccgacgcgtctggttcacgccaaggcccagggcttcgaaattgccgacctgtcccaggac
actcccttgcacgagcagatcgctgccctgctcggcgaacccgaagtggattgcgccatc
gacgccgtaggcttcgaagcacgcggtcacggtcatgctggcgctcaggccgaagcaccc
gccaccgtgctcaactcgttgatgggcgtagtgcgcgtcgccggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggagccgttgacgccgccgccaaaatgggcagcctg
agcattcgcttcggcctgggctgggccaaatcccacagcttccacaccggccagaccccg
gtcatgaaatacaaccgccaactgatgcaggcgatcatgtgggaccgcatcaagatcgcc
gacatagtgggtgtcgaggtgatcagtctggatgatgctccgcggggttatggcgagttt
gattcgggcgtgccgaagaagtttgtgattgatccgcatgggttgtttggtgctgcgtaa

DBGET integrated database retrieval system