KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4737Help
Entry
Psyr_4737         CDS       T00246                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00670  One carbon pool by folate
psb00790  Folate biosynthesis
psb01100  Metabolic pathways
Module
psb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psyr_4737
   00670 One carbon pool by folate
    Psyr_4737
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Psyr_4737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 3370287
NCBI-ProteinID: YP_237802
UniProt: Q4ZM58
Position
5616850..5617362
Genome map
AA seq 170 aa AA seqDB search
MKTHLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRPLP
GRLNLVVSRQTDLQLEGAEVFASLDAAVVRAEQWAQEQGVDEVMLIGGAQLYAQGLPQAD
RLYLTRVALSPDGDAWFPEFDTAQWALVSNTENAAVDGKPAYNFEVWERV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcatctccccctcagcctgattgccgccctcggtgaaaaccgagtgattggc
gtcgacaattccatgccctggcatttgccgggggatttcaaatacttcaaggccacgacg
ctcggcaagccgatcatcatgggccgcaagacctgggattcgttgggccgcccgctgccc
ggccgcctcaatctggtggtcagccgccagaccgacctgcagcttgaaggcgcagaagtc
ttcgcttcgctggacgccgccgtcgtgcgggccgagcagtgggcgcaggaacagggtgtc
gacgaggtgatgctgatcggcggcgcgcagctttacgcgcagggcctccctcaggcagat
cgcctgtacctgactcgcgtggcgctgagccctgatggcgacgcgtggtttccggagttc
gataccgcgcagtgggcgctggtatccaacaccgaaaacgccgcggtcgatggcaagcct
gcctacaatttcgaagtctgggaacgcgtctga

DBGET integrated database retrieval system