KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4940Help
Entry
Psyr_4940         CDS       T00246                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:psb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5856355..5857197)
Genome map
AA seq 280 aa AA seqDB search
MTDSLHNLPHPLLAPVIELTRLAGEVILPFWRANVTVTTKTDDSPVTAADLAAHQVLVEG
LQALDPDIHVLSEEDADIPFRERAGWERWWLVDPLDGTKEFISGSEEFTVNVALIERGRV
VFGVVSMPTNNRCYFGGAGLGAWRSDGVGHLQPIAVRNHLAEGQTFTVVASRRHSSPEQE
HLLAGLSNGLGHLQLTNIGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEV
LQLDGQPFSYPARESLLNPFFLALPANAEWRDKLLVLAQS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgttgcacaacctgccacatccgctgctcgccccggtgattgaactcacg
cgactggcgggcgaagtgatcctgccgttctggcgcgccaatgtcaccgtgaccaccaag
actgacgactcgccggtgaccgccgctgatctggccgcccatcaggtgctggtcgagggc
ctgcaggcgcttgatccggacattcatgtgctctctgaagaggacgctgacatccccttc
cgcgagcgggcaggctgggagcgctggtggctggtcgatccgctggacggcaccaaggag
ttcatctccggcagcgaagagttcaccgtcaatgtcgcactgatcgaacgcggccgcgtg
gtattcggtgtggtctcgatgcccaccaacaaccgttgttacttcggcggtgccgggctg
ggtgcctggcgcagcgatggcgtcggccacctccagccgatcgcagtgcgcaatcatctt
gctgaagggcagacctttacggtggtcgccagccgccgccattccagcccggagcaggaa
catttgctcgcgggcctgtcgaacgggctgggtcatttgcaactgaccaacatcggcagc
tcactgaaattctgcctgctggccgaaggcgccgccgactgctacccgcgcctggccccg
acctcgcaatgggacaccgcagcggcgcagggcgtgcttgaaggtgcaggaggcgaagtg
ttgcaactggacggccagccgttcagctacccggcccgcgaatcactgctcaacccgttc
ttcctggccctgccggccaacgccgaatggcgcgacaaactgctggtgctggcgcagtcc
tga

DBGET integrated database retrieval system