KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_5044Help
Entry
Psyr_5044         CDS       T00246                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00010  Glycolysis / Gluconeogenesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_5044
Enzymes [BR:psb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Psyr_5044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 3370602
NCBI-ProteinID: YP_238109
UniProt: Q4ZLA1
Position
5986112..5987023
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPTVESILYDELNCWRICHGEAELLVAQQGAHILSYQVAGQQPLVWLNEEAVFK
RGKPIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGTEPVVISQALHTYFAVSDV
RQVSVEGLDGLRYIETLANWEEREQSGDLTFTGETDRIYKDTPGVLSIVDPEWQRRIHIR
STGSNSAILWNPWIEKTGKFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWS
EAL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccaccgttgaatccatcctttacgatgagctgaactgc
tggcgtatttgccacggcgaagcagagctgctggttgcgcaacaaggcgcacacatcctc
agctatcaagtggccgggcagcagccgctggtgtggctgaacgaagaggcggttttcaaa
cgcggcaaacccattcgtgccggcatgccgatctgctggccgtggttcggtaacctggag
cgcaacccgcaaagcgtgcaggcaatgcgcgacagcagcgaacctgccaaggcgcatggc
gaagtgcgggcgctggactggcagttgctgggtattggcgcagatggcgacgcactgctg
gtggagttcgtgcttcccgaagccgaaggccacttgcctggctggccgcacaacgtcgcc
ctgaaactgagcattcgtctggaccacgcactgaatgtcagtctggtcagctacaactgc
ggcactgagccagtagtgatcagccaggcactgcacacctatttcgccgttagcgacgta
cgtcaggtcagtgtcgaagggctcgacggcctgcgttacatcgaaaccctggcaaactgg
gaagaacgcgagcagagcggcgacctgaccttcacaggcgaaaccgaccgcatctacaag
gacacgccgggcgtgctcagcatcgttgaccccgagtggcagcgacgcatccacatccgc
agcacgggctcgaactcagccatcctgtggaacccgtggatcgaaaagaccggcaagttc
accgacatggcagcagacggctggcagcgcatggtctgcgtcgaaaccgccaacgtgctg
gacgacgtggtcacgctggcaccggaccagatgcatgtgctgggtgtgagtatctggagc
gaagcgctctga

DBGET integrated database retrieval system