KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_5044Help
Entry
Psyr_5044         CDS       T00246                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_5044
Enzymes [BR:psb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Psyr_5044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5986112..5987023
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPTVESILYDELNCWRICHGEAELLVAQQGAHILSYQVAGQQPLVWLNEEAVFK
RGKPIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGTEPVVISQALHTYFAVSDV
RQVSVEGLDGLRYIETLANWEEREQSGDLTFTGETDRIYKDTPGVLSIVDPEWQRRIHIR
STGSNSAILWNPWIEKTGKFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWS
EAL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccaccgttgaatccatcctttacgatgagctgaactgc
tggcgtatttgccacggcgaagcagagctgctggttgcgcaacaaggcgcacacatcctc
agctatcaagtggccgggcagcagccgctggtgtggctgaacgaagaggcggttttcaaa
cgcggcaaacccattcgtgccggcatgccgatctgctggccgtggttcggtaacctggag
cgcaacccgcaaagcgtgcaggcaatgcgcgacagcagcgaacctgccaaggcgcatggc
gaagtgcgggcgctggactggcagttgctgggtattggcgcagatggcgacgcactgctg
gtggagttcgtgcttcccgaagccgaaggccacttgcctggctggccgcacaacgtcgcc
ctgaaactgagcattcgtctggaccacgcactgaatgtcagtctggtcagctacaactgc
ggcactgagccagtagtgatcagccaggcactgcacacctatttcgccgttagcgacgta
cgtcaggtcagtgtcgaagggctcgacggcctgcgttacatcgaaaccctggcaaactgg
gaagaacgcgagcagagcggcgacctgaccttcacaggcgaaaccgaccgcatctacaag
gacacgccgggcgtgctcagcatcgttgaccccgagtggcagcgacgcatccacatccgc
agcacgggctcgaactcagccatcctgtggaacccgtggatcgaaaagaccggcaagttc
accgacatggcagcagacggctggcagcgcatggtctgcgtcgaaaccgccaacgtgctg
gacgacgtggtcacgctggcaccggaccagatgcatgtgctgggtgtgagtatctggagc
gaagcgctctga

DBGET integrated database retrieval system