KEGG   Pseudomonas stutzeri CCUG 29243: A458_00360Help
Entry
A458_00360        CDS       T02168                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A458_00360 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A458_00360 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A458_00360 (trpA)
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A458_00360 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72181..72993)
Genome map
AA seq 270 aa AA seqDB search
MNSRLQSRFAQLKQENRAALVTFVTAGDPDYATSLAILKGLPDAGADVIELGMPFTDPMA
DGPAIQLANIRALAAKQNLPKTLQMVREFRETNSSTPLVLMGYYNPIFAYGVERFVSDAK
EAGVDGLIVVDLPPEHNDELCDPAQSAGIDFIRLTTPTTDDQRLPVVLNGSSGFVYYVSV
AGVTGAGSATLEHVEEAVARLKRHTDLPVCVGFGIRTPEQAAAIARLTEGVVVGSALIDQ
IAGAKTPEDAVEGVLGLCRQLSAGVRGARG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcccgtctgcagtcgcgcttcgcacagctgaagcaggaaaaccgcgccgcgctg
gtgaccttcgtgaccgccggtgacccggactacgccacctcgctcgccatcctcaagggc
ctgccggatgccggcgccgacgtcatcgagctgggcatgccgttcaccgacccgatggcc
gacggcccggcgatccagctggccaacatccgcgccctggcggcgaagcagaacctgccg
aagacgctgcagatggtccgcgaattccgcgagaccaacagcagcaccccgctggtattg
atgggctactacaacccgatcttcgcctatggcgtcgagcgcttcgtcagcgatgcgaaa
gaagccggtgtcgacggcctgatcgtcgtcgacctgccgccggagcataacgacgaactc
tgcgacccggcccagagcgccggcatcgacttcatccgcctgaccaccccgaccaccgac
gaccagcgcctgccggtcgtgctcaacggcagctcgggcttcgtctactacgtctcggtg
gccggcgtgaccggtgcaggttccgccaccctggaacacgtcgaggaagcggtggcgcgc
ctcaagcgccacaccgacctgccggtgtgcgtcggcttcggcatccgcacgccggagcag
gccgccgccatcgcacggctgaccgaaggcgtggtggtgggctcggcgctgatcgaccag
atcgccggggccaagaccccggaagacgcggtggagggtgtgctcggcctgtgccgccag
ctcagcgccggagtacgcggtgcccgcggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system