KEGG   Pseudomonas stutzeri CCUG 29243: A458_00360Help
Entry
A458_00360        CDS       T02168                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00260  Glycine, serine and threonine metabolism
psc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01130  Biosynthesis of antibiotics
psc01230  Biosynthesis of amino acids
Module
psc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A458_00360 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A458_00360 (trpA)
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A458_00360 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: AFM31340
UniProt: I4CMN3
Position
complement(72181..72993)
Genome map
AA seq 270 aa AA seqDB search
MNSRLQSRFAQLKQENRAALVTFVTAGDPDYATSLAILKGLPDAGADVIELGMPFTDPMA
DGPAIQLANIRALAAKQNLPKTLQMVREFRETNSSTPLVLMGYYNPIFAYGVERFVSDAK
EAGVDGLIVVDLPPEHNDELCDPAQSAGIDFIRLTTPTTDDQRLPVVLNGSSGFVYYVSV
AGVTGAGSATLEHVEEAVARLKRHTDLPVCVGFGIRTPEQAAAIARLTEGVVVGSALIDQ
IAGAKTPEDAVEGVLGLCRQLSAGVRGARG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcccgtctgcagtcgcgcttcgcacagctgaagcaggaaaaccgcgccgcgctg
gtgaccttcgtgaccgccggtgacccggactacgccacctcgctcgccatcctcaagggc
ctgccggatgccggcgccgacgtcatcgagctgggcatgccgttcaccgacccgatggcc
gacggcccggcgatccagctggccaacatccgcgccctggcggcgaagcagaacctgccg
aagacgctgcagatggtccgcgaattccgcgagaccaacagcagcaccccgctggtattg
atgggctactacaacccgatcttcgcctatggcgtcgagcgcttcgtcagcgatgcgaaa
gaagccggtgtcgacggcctgatcgtcgtcgacctgccgccggagcataacgacgaactc
tgcgacccggcccagagcgccggcatcgacttcatccgcctgaccaccccgaccaccgac
gaccagcgcctgccggtcgtgctcaacggcagctcgggcttcgtctactacgtctcggtg
gccggcgtgaccggtgcaggttccgccaccctggaacacgtcgaggaagcggtggcgcgc
ctcaagcgccacaccgacctgccggtgtgcgtcggcttcggcatccgcacgccggagcag
gccgccgccatcgcacggctgaccgaaggcgtggtggtgggctcggcgctgatcgaccag
atcgccggggccaagaccccggaagacgcggtggagggtgtgctcggcctgtgccgccag
ctcagcgccggagtacgcggtgcccgcggttga

DBGET integrated database retrieval system