KEGG   Pseudomonas stutzeri CCUG 29243: A458_00365Help
Entry
A458_00365        CDS       T02168                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A458_00365
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A458_00365
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A458_00365
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A458_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(72999..74210)
Genome map
AA seq 403 aa AA seqDB search
MTSYRSGPDDRGLFGRFGGQFVAETLMPLINQLAAEYEKAKSDPAFLEELAYFQRDYIGR
ASPLYFAERLTEQFGGAKIYLKREDLNHTGAHKINNCIGQILLAKRMGKQRIIAETGAGM
HGVATATVAARFGMQCVVYMGTTDIERQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVHNTFYLIGTAAGPHPYPAMVRDFQSVIGNEVREQIMQKEGRLPDSLVACIGGG
SNAIGLFHPFLDDEAVQIVGVEAAGHGIDTGKHAASMAGGAPGVLHGNRTFLLQDADGQI
TDAHSISAGLDYPGVGPEHAWLHEIKRVEYVPCTDDEALKAFHLCCRLEGIIPALESAHA
LAEAFKRAAKLPKDHLMVVNLSGRGDKDMQTVMHHYDEQEEHI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatatcgcagcggtcccgacgaccgcggcctgttcggccgcttcggcggccag
ttcgtcgccgaaaccctgatgccgctgatcaaccagctggccgccgagtacgagaaggcc
aagagcgatccggccttcctcgaggagctggcctatttccagcgtgactacatcggccgc
gccagcccgctgtacttcgccgagcgcctgaccgagcagttcggcggcgcgaagatctac
ctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaacaactgcatcggccag
atcctgctggccaagcgcatgggcaagcagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgccaccgtggccgcgcgtttcggcatgcagtgcgtggtctacatg
ggcaccaccgacatcgagcgccagcaggccaacgtcttccgcatgaagctcctgggcgcc
gaggtgatcccggtcaccgccggcaccggcacgctgaaggacgcgatgaacgaagccctg
cgcgactgggtgaccaacgttcacaacaccttctacctgatcggcaccgccgccggcccg
cacccctacccggccatggtgcgcgacttccagtcggtgatcggcaacgaagtacgcgag
cagatcatgcagaaggaaggccgcctgcccgactcgctggtcgcctgcatcggtggcggc
tccaacgccatcggcctgttccacccgttcctcgatgacgaagcggtacagatcgtcggc
gtcgaagcggccggtcacggcatcgacaccggcaagcacgccgcgagcatggctggcggt
gcgccgggcgtgctgcacggcaaccgcaccttcctcttgcaggacgccgacggccagatc
accgatgcgcattccatctccgccggcctcgactacccaggcgtcggcccggaacacgcc
tggttgcacgagatcaagcgcgtcgaatacgtgccctgcaccgacgacgaagcgttgaaa
gcgttccacctgtgctgccgactggaaggcatcatccccgcgctggaatcggcccacgcg
ctggccgaagccttcaagcgcgcggcgaagctgcccaaggatcacctgatggtggtcaac
ctctccggccgcggcgacaaggacatgcaaaccgtcatgcaccactacgacgaacaggaa
gaacatatatga

DBGET integrated database retrieval system