KEGG   Pseudomonas stutzeri CCUG 29243: A458_01135Help
Entry
A458_01135        CDS       T02168                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A458_01135
Enzymes [BR:psc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A458_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236528..238375
Genome map
AA seq 615 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLDPHASEPVLLAAALCCEVLSSGDVCLPLGRLAGKRPWP
DQDFSLPPLATWRAQLNASSLIGAPGDYAPLILVGERLYLARYQAYEQQLAEQLLARAAD
APDVDEAQLSDSLARLFAFNQQSPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKADLPVSDAVKDALPDEARTLHRLLGSR
GDSPKVRHDAANPLALDVLVVDEASMVDLALMAKLVAALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDSQAATDLQRITGQAVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINAGDAKGTVALLQEGRADLAWNATPTSAALIERLEQGYSTYLQAARQTDPSAAFEAF
NGFRALTAQREGAFGVTGINEALEARFKRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
IGLCLKTEQGLRVFFEGDEGYRGFAPARLPSHDSAFAMTVHKSQGSEFTEVLLALPEQPS
PLLTRSLFYTGITRAKRKVEIWALPARLAEAVNTRAERAAGLAERLVLPSAQTRATEAVP
AAKQDEPKSDQLSLF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctgcccctcggcccactggagcgcgcctttgtcgccagcctgcag
cgcctcgacccgcatgcgtccgagccggtgctgctcgccgccgcgctgtgctgtgaagtc
ctgtcctccggcgacgtctgcctgccgctgggtcggttagccggcaagcggccatggccg
gatcaggatttcagcctgccgccgcttgcgacctggcgagcgcagctgaacgcctcatcg
ctgatcggtgcgccgggggattacgcaccgctgattctggtcggggaacggctctacctc
gcccgttaccaggcctatgaacagcagttggcggaacagctgctggctcgtgcagcggac
gcacccgatgtcgacgaggctcagctgagcgacagcctggcgcgcttgttcgccttcaat
cagcaaagccccgattggcagcgcctcgccgcggctcaggcggtacgccggcgactggca
gtgatctccggcggtcccggcaccggcaagaccaccactgtggtacgcctgctggcggcg
ttgctggagcagcccggcggcgaacgcctggccatcggcctcgccgcgcccaccggcaag
gccgcggcgcgcatggccgaagcgatccgcaacgccaaggccgatctgccggtcagcgat
gccgtcaaggacgccctgccggacgaggcgcgcaccctgcaccggctgctcggcagccgc
ggcgacagcccgaaggtacggcatgacgcggccaacccgctggcgctggatgtgctggtg
gtggacgaggcatcgatggtcgacctggcgctgatggccaagttggtcgctgcgctgccg
cccaaagcccgactgattctgctcggcgacaaagaccagctggccgccgtggaagccggc
gcggtgttcgccgaactctgtgaagggcgcggtttcgatagtcaggccgcgaccgatctg
caacgcattaccgggcaggccgtacctgtcgagacgccgcgctcgcgccttggcgatgcg
gtggtgctgctcacccacagccatcgattcgccggcgacagcggcatcggcgaactggcg
cggcgcatcaacgctggcgacgccaagggcacggtggcgctgctgcaggaagggcgcgcc
gatcttgcctggaatgccacgccaacgtccgccgcattgatcgagcgactggagcagggc
tattcgacctatctgcaggccgcacgccagaccgatccatccgccgcgttcgaggccttc
aacggtttccgcgcactgaccgcccagcgcgaaggcgcctttggcgtcaccggcatcaac
gaggcgctggaagcgcgcttcaagcgtcgcctcggtgtgcctgcccgcgaacgctggtac
cccggccgcgcggtgatggtccggcagaacgactacgccctgggcctgttcaacggtgat
attggcctgtgtctgaaaaccgagcagggcctgcgggtgttcttcgagggcgacgagggc
tatcgcggctttgccccggcacggttgccgagccacgacagcgccttcgccatgaccgtg
cacaagagccagggctcggagttcaccgaggtgctgctggcgttgccggaacagcccagc
ccgctgctgacgcgctcgctgttctacacgggcatcacccgtgccaagcgcaaggtggag
atctgggcgctgccggcgcggctggctgaagcggtcaatacccgcgccgagcgcgccgca
ggattggccgaacggttggtcctccccagcgcccagaccagagccacagaggcagtgccg
gcggccaagcaagatgagccaaaaagcgatcagctcagcctgttctaa

DBGET integrated database retrieval system