KEGG   Pseudomonas stutzeri CCUG 29243: A458_01215Help
Entry
A458_01215        CDS       T02168                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A458_01215
   00670 One carbon pool by folate
    A458_01215
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A458_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254905..255516
Genome map
AA seq 203 aa AA seqDB search
MTLRRRLYCKAMKPTNGWRFGKLHRSAILAAMNQTRLPLAMIAALAQNRVIGLDNRMPWH
LPADLKHFKAMTLGKPIIMGRKTWDSLGRPLPGRLNLVVSRQADLQLDGAETFTDLDAAL
VRAEQWAREQGVDELMLIGGAQLYSQALGQAQRLYLTRIDAAPEGDAFFPEFDEAEWQCV
ESQPHPAEGEAPAYRFETWQKQS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgacgctgcggcgccgcttgtattgcaaagcgatgaagccgacgaacggctggcgcttc
ggcaagctgcatcgctctgctattctcgccgccatgaatcagacccgccttcccctcgct
atgatcgccgccctcgcgcagaaccgcgtgatcggcctcgacaaccgcatgccctggcac
ctgcccgccgatctcaagcatttcaaggccatgaccctcggcaaaccgatcatcatgggc
cgcaagacctgggattcgctcggccgtccgctgccggggcggctcaacctggtggtcagt
cgccaggcggatctgcagctcgacggcgcggaaaccttcaccgacctggatgccgcgctg
gtgcgtgccgagcagtgggcgcgtgagcagggcgtcgacgagctgatgctgatcggcggt
gcgcagctgtactcccaggcgctggggcaggcgcagcggctgtacctcacgcgtatcgat
gcggctcccgaaggcgatgcgttctttccagaattcgacgaagctgagtggcagtgcgtc
gaaagccagccacatccggctgagggcgaggcaccagcctaccgtttcgaaacctggcaa
aaacagagctga

DBGET integrated database retrieval system