KEGG   Pseudomonas stutzeri CCUG 29243: A458_02050Help
Entry
A458_02050        CDS       T02168                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:psc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:psc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438720..439322
Genome map
AA seq 200 aa AA seqDB search
MSSSAQAILQTRRQPPIEAVVIGASAGGLEALGIVLEGLPSGFRLPILVVQHVPANGPTH
LAEIFGRRTRLLVKEADDKDQLRCGMLYFAAPGYHLLVESDRSLSLSQDDAVHFSRPSID
VLFESAADAWGPRVAGFLLTGANEDGAAGLEAIHRGGGLTVIQDPVEAAVPTMPRAALRR
FAPDYILPLRDIHRLLRELE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcagctccgcgcaggcgattctgcagacccgccgccagccgccgatagaggccgtg
gtgatcggcgcctcggcaggtggactcgaggcactggggatagtcctcgaaggcctgccg
agcggttttcgcttgccgatcctggtggtccagcacgtgccggccaatggcccgacgcat
ctggccgagatattcggacgcagaacccggctgctggtcaaggaagctgacgacaaggac
cagttacgctgcggaatgctgtactttgccgcacccggctaccacctgctggtcgagagc
gaccgcagcctgtccctgagccaggacgatgcggtgcatttttcccgtccgtcgatcgat
gtgctgttcgaatcggcggccgatgcctggggaccgcgggttgcgggcttcctgctgacc
ggcgccaacgaggatggcgccgccggcctcgaggcgattcaccgcggcggcgggttgacc
gtgattcaggaccccgtcgaagcggccgtaccaaccatgcctcgcgccgctctgcggcgc
ttcgcgccggattacatcttgcccctacgcgacattcaccgattgttgcgagaactggag
tga

DBGET integrated database retrieval system