KEGG   Pseudomonas stutzeri CCUG 29243: A458_02195Help
Entry
A458_02195        CDS       T02168                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00010  Glycolysis / Gluconeogenesis
psc00020  Citrate cycle (TCA cycle)
psc00620  Pyruvate metabolism
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
Module
psc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_02195 (aceF)
   00020 Citrate cycle (TCA cycle)
    A458_02195 (aceF)
   00620 Pyruvate metabolism
    A458_02195 (aceF)
Enzymes [BR:psc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A458_02195 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: AFM31695
UniProt: I4CNN8
Position
complement(475961..477967)
Genome map
AA seq 668 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKALKVK
LGDRLKEGDELLELESEEGTDSEAPAQAAAEPAAASTGGPTDEAEAPTPPGDDNPSASAE
EGESQEIKVPDIGSSGKASVIEISVKAGDTIAAEQPLITLESDKASMEIPSPAAGVVESI
SVKVGDEVGTGDLILILKGTASSKPAAASAPASQAQGPAKEKLTEQAAEAPAETAGESVE
EVRIPDIGSSGSAKVIEVMIKAGDSVEADQSLITLESDKASMEIPAAKAGVVESLSIKVG
DDAKTGDLILTLKVQGSAPAKKAESRPQEAVSQQQAVAPNKQGVPEAKAAATPAPAVSGP
SKAGTKVHAGPAVRMTAREYGVDLTDVPATGPKGRILKEDVQAYVKNMLHKAKQAPAEGA
SGGAGIPPIPAVDFSKFGEVEEVAMSRLMQIGAANLHRSWLNVPHVTQFESADITELEAF
RVSQKAAAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHIGFAVDT
PDGLMVPVIKNVDQKSLLQLAGEAAELAEKARSKKLSPDAMQGACFTISSLGHIGGTGFT
PIVNAPEVAILGVSKATMQPVWDGKAFEPRLMLPLSLSYDHRVINGAAAARFTKRLSELL
ADIRTLLL
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagcggtgagggtgaagtaatcgagttg
ttcgtcaaggtcggcgaccgtatcgaagcggaccagagcatcctgacgctggagtccgac
aaggccagcatggaaatcccggcacccaaggctggcgtcgtgaaggccttgaaggtcaag
ctcggcgaccgcctgaaagaaggtgacgagctacttgagctggaaagcgaagaaggaact
gacagcgaagcgccggcgcaagccgcggccgagcctgccgctgccagcactggcggcccg
actgatgaagccgaagcacctacgcctccgggagatgacaatccttcagcctccgccgag
gaaggcgagtcgcaggaaatcaaggttccggacatcggctcctccggcaaggccagcgtg
atcgagatttcggtgaaggccggcgataccatcgccgccgagcaaccgctgatcactctc
gagtccgacaaggccagcatggagatcccctctccagccgctggcgtagtcgagagcatt
tcggtcaaggtgggcgacgaagtcggtaccggcgacctgatcctgatcctcaagggtacc
gcctcgagcaagccggcagcggccagtgctccggccagccaggcacaaggcccggccaag
gagaagctgaccgagcaggccgcagaagcaccggccgaaactgcaggcgagtccgtggag
gaggttcgtattccggacatcggttccagcggcagcgccaaggtcatcgaagtcatgatc
aaggccggcgacagcgtcgaggcggaccagtcgctgatcaccttggaatccgacaaggcc
agcatggaaattccggcggccaaggcgggcgtggtggagtcgctgtcgatcaaggtgggt
gacgatgccaagaccggcgacctgatcctgaccctcaaggtccagggctcggcgccagcg
aaaaaggccgagagcaggccgcaggaggccgtttcccagcagcaggccgtcgcaccgaac
aagcagggcgtaccggaggcgaaggccgcggcgacgccggctccggccgtcagcggcccg
agcaaggccggcaccaaggttcacgccgggccggcggttcgcatgaccgcgcgcgagtac
ggcgtcgacctcaccgatgttccggccaccggtcccaagggccggattctcaaggaagat
gtccaggcctacgtcaagaacatgctgcacaaggccaagcaggctccggccgaaggtgcc
tcgggcggtgccggcattccgccgatcccggccgtggacttcagcaagttcggcgaagtc
gaagaagtcgcgatgtcgcgcctgatgcagatcggcgcagccaacctgcaccgcagctgg
ctgaacgtaccgcacgtgacccagttcgaatcggccgacatcaccgaactggaggccttc
cgcgtctcccagaaggctgccgccgagaaggccggcgtcaagctcaccgtgctgcctttg
ttgctcaaggcgtgtgcgcacctgctcaaggagctgccggacttcaacagctcgctggcg
ccaagcggcaaggcactgatccgcaagaagtacgtgcacatcggcttcgccgtggatacg
ccggatggcctgatggtcccggtgatcaagaacgtggatcagaagagcttgctgcagttg
gctggcgaagcggccgagctggcagagaaagcgcgcagcaagaagctttcgcctgacgcc
atgcagggtgcctgcttcaccatttccagccttggccacattggcggcaccggcttcacg
ccgatcgtcaacgcgccggaagtggcgattctcggggtatccaaggcgacgatgcagcca
gtctgggacggcaaggcattcgagccgcgcctgatgttgccgctctcgctgtcctacgat
caccgtgtgatcaacggggctgctgccgcacgcttcaccaaacggctgtcggagctgctg
gcggatatccgcacgctgctgctgtaa

DBGET integrated database retrieval system