KEGG   Pseudomonas stutzeri CCUG 29243: A458_03050Help
Entry
A458_03050        CDS       T02168                                 

Definition
aldehyde dehydrogenase family protein
Orthology
K00138  
aldehyde dehydrogenase [EC:1.2.1.-]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_03050
   00620 Pyruvate metabolism
    A458_03050
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     A458_03050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(673209..674729)
Genome map
AA seq 506 aa AA seqDB search
MIYAPPGTDGALVTLKARYGNFINGEFVEPVNGQYFTNLSPVNGQPIAEFPRSDAADIEK
ALDAAHAAADAWGKTSVQARSLILLQIADRIEQNLEMLAVTETWDNGKAVRETLNADIPL
AADHFRYFAGCIRAQEGTAAEIDEHTAAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPLGIAVLMEVIGDLLPPGVLNVVQGYGREAGEALASSKRIAKIAFTG
STPVGSHIMKRAAESIIPSTVELGGKSPNIYFEDIMQAEPTFIEKAAEGLVLGFFNQGEV
CTCPSRALVQESIYAPFMEAVMKKVAQIKRGDPLDTETMVGAQASQQQFDKIMSYLEIAK
GEGAEVLTGGAAEKLEGSLATGYYIQPTLLKGTNQMRVFQEEIFGPVIGVTTFNDEAEAL
AIANDTEYGLGAGVWTRDINRAYRMGRAIKAGRVWTNCYHLYPAHAAFGGYKKSGVGRET
HKMILDSYQQTKNLLISYDINPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcccctcccggcaccgacggtgccctcgttaccctcaaggcccgctacggc
aacttcatcaatggcgagttcgtcgaacccgtcaacgggcagtatttcaccaacctgtct
ccggttaacggacagccgattgccgagtttccgcgctccgacgccgccgacatcgagaag
gcgctggacgccgcccatgccgctgccgatgcctggggcaagaccagcgtgcaggcgcgc
tcgctgatcctgttgcagatcgccgaccgtatcgagcagaacctggagatgctcgccgtc
accgaaacctgggacaacggcaaggccgtgcgggaaacgctgaacgccgatatcccgctg
gcggctgaccacttccgttacttcgccggctgcatccgcgcccaggagggcaccgcagcc
gagatcgacgagcacaccgcggcctatcacttccatgagccgctgggcgtggtcgggcag
attatcccgtggaacttcccgatcctgatggccgcctggaaactcgccccggcactggcg
gcaggcaactgcgtggtgctgaaaccggccgagcagacccctctaggtatcgcagtgctg
atggaagtcatcggcgacttgctgcctccgggcgtgctcaacgtcgtgcagggctacggt
cgtgaagccggcgaggccctggcctcgagcaagcgcatcgccaagatcgctttcaccggc
tccaccccggtgggctcgcacatcatgaagcgcgccgcggaaagcatcatcccgagcacc
gtggaactgggcggcaagagcccgaacatctacttcgaagacatcatgcaggccgaaccg
accttcatcgagaaggccgccgaaggcctggtgctgggcttcttcaaccagggcgaggtg
tgcacctgcccatcccgcgcgctggtgcaggaatccatctacgcccccttcatggaagcg
gtgatgaagaaggtcgcgcagatcaagcgcggcgacccgctggatacggaaaccatggtc
ggcgcccaggccagccagcagcagttcgacaagatcatgtcctacctggaaatcgccaaa
ggggaaggcgcggaagtgctcaccggcggcgcagcggagaaactcgaaggctcgctcgcc
accggttattacatccagccgaccctgctcaagggcaccaaccagatgcgtgtgttccag
gaggagatcttcggcccggtgatcggcgtcaccaccttcaacgacgaggccgaagccctg
gccatcgccaacgacaccgagtacggcctcggcgctggcgtatggacccgcgacatcaac
cgcgcctaccgcatgggccgggcgatcaaggcgggccgtgtctggaccaactgctaccac
ctctatccggcgcatgccgcgttcggtggctacaagaagtccggcgtcggtcgcgaaacc
cacaagatgatcctcgacagctaccagcagaccaagaacctgctgatcagctacgacatc
aacccgctgggcttcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system