KEGG   Pseudomonas stutzeri CCUG 29243: A458_03705Help
Entry
A458_03705        CDS       T02168                                 

Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    A458_03705
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     A458_03705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818474..820387
Genome map
AA seq 637 aa AA seqDB search
MSDKSKNNPEVLEKGGMSRRGFLGASAVTGAAVAATAFGGAVMSRESWAAAVKDAQQNIH
VAPGELDDYYGFWSGGHQGEVRVMGVPSMRELMRIPVFNVDSATGWGLTNESRAILGDSA
KFLNGDCHHPHISMTDGKYDGKYVFINDKANTRVARIRLDIMKCDKILTVPNCQAIHGLR
LQKVPYTKYVYANAEFVIPHPNDGKVFDLQDENSYTMYNVIDAEKMEMAFQIIVDGNLDN
TDADYTGRFTAATCYNSEKAYDLGGMMRNERDWVVVFDIEAAEKAVKAGKFITLDDSKVP
VLDGRKKGDKDSEFTRYIPVPKNPHGCNTSSDGKYFIANGKLSPTVSMIEIAKLPDLFAG
KLADPRDTIAAEVELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMADAVRAYKGEKVNYI
KQKLDVHYQPGHIHASLCETSEADGKWLVALCKFGKDRFLPTGPLHPENDQLIDISGDEM
KLVHDGPTFAEPHDCVMARRDQIKTKKIWDRNDPFFAGTVDMAKKDGINLETDNKVIRDG
NKVRVYMTSMAPAYGVQEFNVKQGDEVTVVITNIDQIEDVSHGFVMVNHGVSMEISPQQT
SSITFIADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaagagcaagaacaatcccgaggtgctggagaagggcggcatgagccgtcgt
ggcttcctcggcgccagcgccgttaccggtgcggccgttgcggcgactgccttcggtggc
gcggtgatgagccgtgaatcctgggccgccgcggtcaaggatgcacagcagaacatccat
gtcgcgcccggcgagctggatgactactacggcttctggagcggcggccaccagggcgaa
gtacgtgtgatgggtgtgccgtcgatgcgtgagctgatgcgcatcccggtgttcaacgtt
gactcggccaccggttggggcctgaccaacgaaagccgcgcgatcctgggcgacagtgcc
aagttcctcaacggcgactgccaccacccgcacatctccatgaccgacggcaagtacgac
ggcaagtacgtgttcatcaacgacaaggccaacacccgcgtcgcgcgtattcgtctggat
atcatgaagtgcgacaagatcctgaccgtaccgaattgccaggcgatccacggcctgcgc
ctgcagaaggtgccgtacaccaagtacgtttacgccaacgccgaattcgtcattccgcac
ccgaacgacggcaaggtcttcgatctgcaggatgaaaacagctacaccatgtacaacgtc
atcgacgccgaaaagatggagatggccttccagatcatcgtcgacggtaaccttgacaac
accgacgccgactacaccggccgcttcactgctgctacctgctacaactcggaaaaggcc
tacgacctcggcggaatgatgcgcaacgagcgcgactgggtcgtggtgttcgacatcgaa
gctgctgaaaaagcagtcaaggccggcaagttcatcaccctggacgactccaaggtgccg
gtgctcgatggtcgcaagaagggcgacaaggacagcgaattcactcgctacattccggta
ccgaagaacccgcacggctgcaacacctcgtcggatggcaagtacttcatcgccaacggc
aagctgtcgccgaccgtgtcgatgatcgagatcgccaagctgcccgatcttttcgccggc
aaactggccgatccgcgtgacaccatcgccgctgaagtggaactgggcctgggcccgctg
cacaccaccttcgacggtcgcggcaatgcttacaccaccctgttcatcgacagccaggtg
gtcaagtggaacatggctgacgcggtccgcgcctacaagggcgagaaggtcaactacatc
aagcagaagcttgacgtgcactaccagccgggccatatccacgcctcgctctgcgaaacc
agcgaagccgatggcaagtggttggtcgcgctgtgcaagttcggcaaggaccgcttcctg
ccgaccggcccgttgcacccggaaaatgaccagttgatcgatatctccggcgatgagatg
aagctggtgcacgacggccctacttttgccgagccacacgactgcgtcatggctcgtcgc
gaccagatcaagaccaagaagatctgggaccgcaacgacccgttcttcgctggtaccgtg
gacatggcgaagaaggacggtatcaacctggagaccgacaacaaggtcatccgcgacggc
aacaaggtgcgcgtgtacatgacctccatggcgccggcatacggtgtgcaggagttcaac
gtcaagcagggcgacgaagtcaccgtggtcatcaccaacattgaccagatcgaagacgtg
tctcacggcttcgtcatggtcaaccatggcgtgagcatggagatcagcccgcagcagacc
tcttccatcacctttatcgctgacaagccggggctgcactggtactactgcagctggttc
tgccacgcgctgcacatggaaatggtcggccgcatgatggtcgagccggcgtaa

DBGET integrated database retrieval system