KEGG   Pseudomonas stutzeri CCUG 29243: A458_04115Help
Entry
A458_04115        CDS       T02168                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A458_04115 (tpiA)
   01230 Biosynthesis of amino acids
    A458_04115 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_04115 (tpiA)
   00051 Fructose and mannose metabolism
    A458_04115 (tpiA)
   00562 Inositol phosphate metabolism
    A458_04115 (tpiA)
Enzymes [BR:psc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A458_04115 (tpiA)
Exosome [BR:psc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A458_04115 (tpiA)
  Exosomal proteins of bladder cancer cells
   A458_04115 (tpiA)
  Exosomal proteins of melanoma cells
   A458_04115 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918321..919076
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMNGTRASVAELVESLRMQVLPADVEIAVFPSAVHVSQVLDGVDGEHVAV
GTQDCAAQNGFGALTGEVSAEQFADFGCKWVLVGHSERRLLLGETDEVVSRKFSAAQVGG
LKPVLCLGETLEERRAGKTLEVVGRQLARVLDDRGVAAFESAVIAYEPVWAIGSGLTATP
EQAQEVHAAIREQLSRHDGRIAEGVRLLYGGSVKAENAAELFAMSDIDGGLVGGASLKAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgccccatggtagctggtaactggaaaatgaacggtacccgcgctagcgtcgca
gagcttgtcgagtctctccggatgcaggttttgcctgcggatgtcgagattgcggtgttt
ccctccgctgtgcatgtctctcaggttctggatggtgttgatggtgagcatgttgccgtc
ggtacccaggattgtgcggcgcagaatggcttcggggcgctgaccggtgaggtttcggct
gagcagttcgctgatttcggttgtaagtgggttctggttggtcactccgaacgtcgcctg
ttgttgggtgagacggacgaagtggtcagtcgcaagttttcggcagcgcaggtgggtggt
cttaagcctgtgttgtgcctgggtgagacgcttgaagagcgacgggcaggcaagacgctc
gaagtggttgggcgtcagttggcgcgagtgctggatgaccgtggtgtcgccgcattcgag
tcggcggttattgcttacgagcctgtttgggcgattggtagtggcttgaccgcaacgcct
gagcaggcgcaggaagtacatgctgccattcgagagcagttgtcgcgtcatgatggccgc
atcgctgaaggcgtaaggcttctgtacggcggcagcgtcaaggcggagaatgccgctgag
ctattcgcaatgtcggatattgacggggggttggttggtggagcctctctgaaagcggat
gaatttggtgcgatctgtcgcgccgcggggaactga

DBGET integrated database retrieval system