KEGG   Pseudomonas stutzeri CCUG 29243: A458_06515Help
Entry
A458_06515        CDS       T02168                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A458_06515
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A458_06515
   00650 Butanoate metabolism
    A458_06515
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A458_06515
   00622 Xylene degradation
    A458_06515
   00621 Dioxin degradation
    A458_06515
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     A458_06515
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     A458_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1434307..1435230)
Genome map
AA seq 307 aa AA seqDB search
MSKKLKAAIIGPGNIGTDLVMKMLRSEWIEPVWMVGIDPESDGLKRAREFGLKTTAEGVD
GLLPHVLEDDIRIAFDATSAYVHAENSRKLNELGVLMVDLTPAAIGPYCVPPVNLKQHVG
TLEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSRSIGPGTRKNIDEFTRTTAG
AIEQVGGAKEGKAIIVVNPAEPPLMMRDTIHCLTETEPDQDAITASVHAMIAEVQKYVPG
YRLKNGPVFDGNRVSIFMEVEGLGDYLPKYAGNLDIMTAAALRTGEMFAEEIASGTIQLP
RREAALA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaactgaaagccgccattatcggcccgggcaacatcggcacagatctggtg
atgaagatgctgcgttccgagtggatcgagccggtctggatggtcggcatcgaccccgag
tccgatggcctcaagcgcgcccgcgagttcggcctgaagaccaccgccgagggcgtcgac
ggcctgctgccgcacgtgctcgaggacgatatccgcatcgccttcgatgccacctccgcc
tatgtacacgccgagaacagccgcaagctcaacgagctgggcgtgctgatggtcgacctg
accccggccgccatcggcccgtactgcgtgccgccggtgaacctcaagcagcatgtcggc
acgctggaaatgaacgtcaacatggtcacctgtggtggccaggccaccatcccgatggtc
gccgcggtatcgcgcgtgcagccggtggcctacggcgagatcgtcgccaccgtgtcctcg
cgctccatcggcccgggcacccgcaagaacatcgacgagttcacccgcaccaccgccggc
gccatcgagcaggtcggcggggccaaggaaggcaaggcgatcatcgtcgtcaacccggcc
gagccgccgctgatgatgcgcgacaccatccactgcctgaccgaaaccgaaccggaccag
gatgcgatcaccgcatcggtccacgcgatgatcgccgaggtgcagaagtacgtgcccggc
taccggctgaagaatggcccggtattcgacggcaaccgcgtctcgatcttcatggaggtc
gagggcctgggcgactacctgcccaagtacgccggcaacctcgacatcatgaccgccgcc
gccctgcgcaccggcgagatgttcgccgaggaaatcgccagcggcaccattcaactgcca
cgtcgtgaagcggcactggcctaa

DBGET integrated database retrieval system