KEGG   Pseudomonas stutzeri CCUG 29243: A458_07255Help
Entry
A458_07255        CDS       T02168                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:psc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562017..1562565
Genome map
AA seq 182 aa AA seqDB search
MNITRPLAALSLAFASASVIAAECPALLQHELPKLRSKETVDLCSQFQGKALVVVNTASH
CGFTGQFKGLEALYQRYKDDGLEVLGVPSDDFFQEADDEAETAEVCYVNYGVTFTMTQTQ
PVRGGDATPLFRQLAEQAGAAPRWNFYKYMVDREGRVVAHFSSKVAPDDPRLIAAVEKAL
ER
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcactcgtcccctggcggcactgtcgctggcctttgccagcgcctcggtgatt
gccgccgaatgcccggcactgctgcagcacgagttgcccaagctgcgctccaaggaaacc
gtcgatctgtgcagccagttccagggcaaggccctggtggtggtcaataccgccagccat
tgcggctttaccgggcagttcaagggactcgaagcactctatcaacgctacaaggacgac
ggcctggaggtgctcggcgtgccctcggatgacttcttccaggaggccgatgacgaggcc
gagacggccgaggtctgctacgtgaattacggtgtgaccttcaccatgacccagacgcag
ccagtacgaggtggcgatgcgacgccgttgtttcgccagctggcagagcaggccggagca
gcgccgcgctggaacttttacaagtacatggtcgatcgggaagggcgcgtcgtcgcgcat
ttttccagcaaggtcgcgccggatgacccgcgcctgatcgcagcggtggagaaggcgttg
gaacggtag

DBGET integrated database retrieval system