KEGG   Pseudomonas stutzeri CCUG 29243: A458_07645Help
Entry
A458_07645        CDS       T02168                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:psc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1638784..1640556)
Genome map
AA seq 590 aa AA seqDB search
MCGIAGELRFDNRPADLAAVERITQHLTARGPDACGFHSQGPLALGHRRLKIMDLCEASG
QPMIDSALGLSMVFNGAIYNYPELRAELEGLGYRFFSEGDTEVLLKGFHAWGEALLPRLN
GMFAFAIWERDSQQLFIARDRLGVKPLYLSRTDQRLRFASSLPALLKGGDIAGVLNPVAL
NHYMSFHAVVPAPDTLIAGIEKLPPASWMRVDANGATTTQRWWELEFGAREEERNYSFED
WKQRTLDTMREAVAIRQRAAVDVGVLLSGGVDSSLLVGLLREAGVADNLLTFSIGFEDAG
GERGDEFKYSDLIAKHYNTRHHQLRIQEKEILEQLPAAFQAMSEPMVSHDCIAFYLLSRE
VAKHCKVVQSGQGADELFAGYHWYPLVDGAEDPVAAYLAAFRDRTYEEYAETVQQQWVQG
DFSGDFVRQHFAQPGADAAVDKALRIDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRV
AELSARIPARFKLPEGGKYVLKEAARQVIPAEVIDRPKGYFPVPGLKHLQGATLNWVREM
LLDPSQERGLYNPQALEKLLADPDGQLTPLRGSKLWQLAAVNLWLSEQGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatagctggagaacttcgcttcgataaccgcccggccgatctggctgcggtt
gaacgcatcactcaacacctgactgcgcgcggccccgacgcatgcggtttccacagccag
ggcccactcgccctgggtcatcggcgcctgaagatcatggatctgtgcgaggcgtccggc
cagccgatgatcgactcggccctcggcctgtcgatggtcttcaacggcgccatctacaac
taccccgaattgcgcgcagagctggaaggcctgggctaccgcttcttctccgaaggcgat
accgaagtgctgctcaagggcttccatgcctggggcgaagcgctgctgccgcggctgaac
ggcatgttcgcctttgccatctgggagcgcgacagccagcagctgttcatcgcccgcgac
cgtctcggcgtcaagccgctgtacctgtcgcgcaccgaccagcgcctgcgcttcgcctcg
tcgctgccggcattgctcaagggcggcgatatcgccggtgttttgaatccggtggcgctg
aatcactacatgagtttccacgccgtggttccggctccggacacgctgatcgccggtatc
gagaaattgccgccggccagctggatgcgcgtcgacgctaatggcgcgaccaccacccag
cgctggtgggagctggaattcggcgcccgagaagaggagcgcaactacagctttgaagac
tggaaacagcgcaccctggacaccatgcgcgaggcggtggcgatccgtcagcgcgcagcg
gtggatgtcggcgtactgctctccggtggtgtcgactccagcctgctggtcggcctgctg
cgcgaagccggtgtggccgacaatctactgacattttccatcggcttcgaagatgccggc
ggcgagcgcggcgacgagttcaagtactcggatctgatcgccaagcactacaacacgcgc
caccatcagctgcgcattcaggaaaaggaaatcctcgaacagctgccggccgccttccag
gcgatgagcgagccgatggtcagccatgactgcatcgccttctacctgctctcgcgggaa
gtggccaagcactgcaaggtggtgcagagcggccagggtgcggacgaactgttcgccggc
taccactggtatccgctggtggacggcgccgaagacccggtggcggcctacctcgccgcg
ttccgcgatcgcacgtacgaggaatatgccgagaccgtgcagcagcagtgggtccagggc
gacttctccggcgacttcgtccgtcagcacttcgcccagcccggcgccgatgcggcggtg
gacaaggcgctgcgtatcgacagcacggtgatgctggtcgatgacccggtcaagcgcgtc
gacaacatgaccatggcctggggcctggaggcgcgcacgccgttcctcgactaccgcgtg
gccgaactgtcggcgcgcatcccggccaggttcaagctgcccgagggcggcaagtatgtg
ctcaaggaagcggcgcgccaggtgattcctgccgaggtgatcgaccggcctaaaggctac
ttcccggtgccgggcctcaagcacttgcagggtgcgacgctgaactgggtgcgcgagatg
ctgctcgaccccagccaggagcgcggcctctacaacccgcaggcactggagaagctgctc
gccgatccggatggccagctcacgccgctgcgcggttcaaaactctggcagctggcagcg
gtcaacctatggttgagcgagcaaggcctttga

DBGET integrated database retrieval system