KEGG   Pseudomonas stutzeri CCUG 29243: A458_08590Help
Entry
A458_08590        CDS       T02168                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A458_08590
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A458_08590
Exosome [BR:psc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A458_08590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1847832..1849340)
Genome map
AA seq 502 aa AA seqDB search
MSNQNKQFVVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQS
GVFVEALAQAGITNEQVAAIGITNQRETAIVWDKITGRPIYNAIVWQSRQSTPICDQLKR
DGMNDHIRQTTGLVIDPYFSGTKIKWILDHVEGSRERARRGELLFGTVDCWLIWKMTQGK
AHVTDYTNASRTMLFDIHKLDWDPVMLEALDIPREMLPEVRSSSEIYGHAYIGSGQSTGI
PIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGTKAVQSEHGLLTTIACGPRGE
VNYALEGAIFNGGSTVQWLRDELKVLNESLDSEYFATKVPDSNGIYLVPAFTGLGAPYWD
PRARGALFGLTRGVKVDHLIRAALESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANNF
LMQFQADLLGTQVERPQMKETTALGAAYLAGLATGFWSDLDELRSKSSIERVFEPACGSE
QREALYRGWQKAVDRTRNWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcagaacaagcaattcgtcgtcgccctcgaccagggcaccaccagttcccgc
gccatcgtgctggaccgcaacgccaacgtggtgaccatcgcccagcgcgaattcgcgcag
atctacccgcaaccgagctgggtcgagcacgatcccatggagatctgggcgacccagagc
ggcgtgttcgtcgaagccctggcccaggccggcatcaccaacgagcaggtggcggcgatc
ggcatcaccaaccagcgcgagaccgccatcgtctgggacaagatcactggccggccgatc
tataacgccatcgtttggcagagccgccagagcacgccgatctgcgaccagctcaagcgc
gacgggatgaacgatcacatccgccagaccaccggactggtgatcgacccctacttctcc
ggcacaaagatcaagtggattctcgatcacgtcgagggcagccgcgagcgcgcccgccgt
ggcgagctcctgttcggcaccgtcgactgctggctgatctggaagatgacccagggcaag
gcccacgtcaccgactacaccaacgcctcgcgcaccatgctcttcgacatccacaagctg
gactgggacccagtgatgctcgaagcgctggatatcccccgcgaaatgctgccagaggtg
cgctcgtcgtcggagatctacggccacgcctacatcggctccgggcagagcaccggcatt
cccatcgccggtatcgccggcgaccagcaggccgcgctgttcggccagatgtgcgtcgag
ccgggccaggccaagaacacctacggcaccggctgcttcctgctgatgaacaccggcacc
aaggcagtgcagtccgagcacggcctgctgactaccatcgcctgcgggccgcgtggcgaa
gtgaactacgcgctggaaggcgccatcttcaacggtggctccaccgtgcagtggctgcgt
gacgagctgaaggtgctcaacgaatcgctggattccgaatacttcgccaccaaggtgccg
gacagcaatggcatctacctggtgccggcgttcaccggtctcggcgcgccctattgggat
ccgcgcgcccgtggcgcgctgttcggcctgacccgcggggtcaaggttgatcacctgatc
cgagcagcattggaatccatcgcttaccagacccgcgacgtgctcgatgccatgcagcag
gatgccggcgagcgcctgcgcgccctgcgcgtggacggcggcgcagtggccaacaacttc
ctcatgcagttccaggccgacctgctcggcacccaggtcgaacgcccgcagatgaaggaa
accaccgccctcggagcggcctacctggccgggctggcgaccggtttctggagcgatctc
gacgagttgcgcagcaagagcagcatcgagcgggtgttcgaaccggcgtgcggaagcgaa
cagcgcgaagcgctctatcgcggctggcagaaggcggtcgaccgtacgcgcaactgggcc
gaggactga

DBGET integrated database retrieval system