KEGG   Pseudomonas stutzeri CCUG 29243: A458_09230Help
Entry
A458_09230        CDS       T02168                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A458_09230
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    A458_09230
Enzymes [BR:psc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     A458_09230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1993838..1995433)
Genome map
AA seq 531 aa AA seqDB search
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDSAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEVSAADLN
NGDVVLNREGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHVGQ
IAAMVDEIRKTIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaagacgacatcaaggcagttgccgccctgaaagagcaatacggcagc
agctgggccgccatcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaag
accggtctggaaattgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtctacacgcagtccctcggttgctggcacggcttcatcggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgttacctctacctg
tccggctggatggttgctgctctgcgctccgagttcggcccgctgccggaccaatccatg
cacgagaagactgccgtttccgacctgatcgaagagctgtacaccttcctgcgtcaggct
gacagccgcgagctggacctgctgttcaccgctctggacgccgctcgcgaagctggcgac
agcgccaaggctgccgagatccagaaccagatcgacaactacgaaacccacatcgtaccg
atcatcgccgacatcgacgctggcttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaag
cagtgcggccaccaggacggtaaagtgaccgttccccacgccgacttcctcgccaagatc
gcagctgtgcgttacgccttcctcgagctgggcatcgacaacggtgtgatcgttgctcgt
accgactccctgggtgccggcctgaccaagcagatcgccgtgaccaaagagccgggcgac
ctgggcgacctgtacaactccttcctggattgtgaagaagtctccgctgccgatctgaac
aacggtgacgtggttctgaaccgcgaaggcaagctgctgcgtccgaagcgtctgccgtcc
aacctcttccagttccgcgctggcaccggtgaagcacgctgcgtactggactgcatcacc
tcgctgcagaacggtgctgacctgctgtggatcgaaaccgagaagccgcacgttggtcag
atcgcggccatggttgacgaaatccgcaagaccatcccgaacgccaagctggtctacaac
aacagtccgtcgttcaactggacgctgaacttccgtcagcaggtcttcgatgcgttcgtc
gccgaaggcaaagacgtttccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gaaaccgaactggcccaggttgcagacgagaagatccgtaccttccagcgcgacggttcg
gctcacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaaggggtacttcgccgaccagggtatgctggcgtacgtgaag
ggcgttcagcgtcaggaactgcgtcagggcatcgcctgcgtcaagcaccagaacatggct
ggttccgacatcggcgacaaccacaaggagtacttcgctggcgaagccgctctgaaggca
agcggtaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system