KEGG   Pseudomonas stutzeri CCUG 29243: A458_09990Help
Entry
A458_09990        CDS       T02168                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A458_09990
Enzymes [BR:psc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     A458_09990
Exosome [BR:psc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A458_09990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2173086..2175299
Genome map
AA seq 737 aa AA seqDB search
MTDRPVLTMPGETLMPSDADVDALVRAEHGNPFSILGPHPDGGGIVIRAYLPNALGAEVL
DRDEQLLAVMEQGQVPGFFFIRLPHQQPYLLKIRWAGGEQITEDPYSFGPQLGELDMHLF
SEGNHRQIGRVFGSQVLEVDGVQGVRFAVWAPNARRVSIVGSFNGWDGRRHPMRLRFPSG
VWELFIPRLQPGDTYKYEILGPNGILPLKADPIALATEHPPGTASVIARPLDYQWKDHGW
LQQRAARQSVKAPMSIYELHAGSWRRDGGDDGRLYDWHELAERLIPYVVDMGFTHIELMP
IMEHPFGGSWGYQLLSQFAPSARYGNAHDFAEFVDACHNAGIGVILDWVPAHFPTDAHGL
GEFDGTALYEYAHPFEGFHQDWDTYIYNLGRTEVHGFMLASALHWLREFHVDALRVDAVA
SMLYRDYSRKDGEWIPNRHGGRENLEAIDFLRHLNDVVATETPGALVIAEESTAFPGVSK
PTSEGGLGFSYKWNMGWMHDSLKYIQEDPINRQYHHDKMTFSMVYAYSEHFVLPISHDEV
VHGKGSLVDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGSEFGQWREWNHDRELDWHL
LEEADHRGVQNLVRDLNRLYSQEPALHELDSDPQGFQWLIGDDRANSVFAWLRKSSTGHP
LLVVANFTPVVREAYRIGVPVEAKWLEVFNSDAACYGGSNTGNGGGMLAEPVESHGEKVS
LSLTLPPLGVLVLRPQV
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgtccggttctgaccatgccaggggaaaccctgatgcccagcgacgccgat
gtagacgccctggtgcgagccgagcatggcaacccgttttccattctcgggccgcatcct
gacggcgggggaatcgtgattcgcgcctacctgcccaatgccctgggtgccgaagtgctc
gaccgcgatgagcaactgcttgccgtgatggagcaggggcaggtgcccggattcttcttt
atccgcctgccacatcagcaaccctacctgctgaagattcgctgggccggcggcgagcag
attaccgaagacccctacagcttcggtccgcaactgggcgagctggacatgcacctgttt
tccgaaggcaatcaccggcagatcggccgggtattcggctcgcaggtgctggaagtggac
ggtgtgcagggcgtgcgcttcgccgtgtgggcgcccaacgcgcgccgagtgtcgatagtc
ggcagcttcaatggctgggacggtcgccgtcatccgatgcggctgcgctttccgtccggc
gtgtgggagctgttcatccctcgcctgcagccgggcgatacctacaagtacgagattctc
ggaccgaacggcatcctgccgctcaaggccgacccgatcgccctggcaaccgagcacccg
ccgggcaccgcttcggtcatagcccggccgctggactaccagtggaaggaccatggctgg
ttgcagcagcgcgccgcgcgccagtcggtcaaggcgccgatgagcatctacgagctgcat
gcgggctcctggcgacgtgacggtggtgacgatggccgcctgtacgactggcacgaactg
gccgagcgcctgatcccctacgtagtggacatgggtttcacccacatcgagctgatgccg
atcatggagcatcccttcggtggctcatggggctaccagctgctctcgcagttcgcgccg
agtgcgcgctacggcaacgcccatgatttcgccgagttcgtcgacgcctgccataacgcc
ggcatcggtgtgatcctcgactgggtgccggcgcactttcccaccgacgcccatggcctg
ggcgaattcgacggcaccgcgctgtacgaatacgcacacccgttcgagggcttccatcag
gactgggatacctacatctacaacctcggccgcaccgaggtgcacggcttcatgctcgct
tcggcgctgcactggctgcgcgagttccacgtcgatgccctgcgtgtcgatgcggtggct
tcgatgctctatcgcgactattcgcgcaaggacggcgagtggattcccaaccgccatggc
gggcgcgagaacctcgaggcgatcgacttcctgcgccatctgaacgacgtggtggccacg
gaaacccctggcgcgctggtgatcgccgaggaatcgacagcctttccgggcgtcagcaag
cctaccagcgaaggtggcctcggcttctcctacaagtggaacatgggctggatgcacgac
tcgctgaagtacatccaggaagacccgatcaatcggcagtaccaccacgacaagatgacc
ttcagcatggtctacgcctattccgagcacttcgtcctgccgatttcccacgacgaagtg
gtccacggcaaaggctcgctggtcgacaagatgcccggggatcgctggcagaagttcgcc
aacctgcgcgcctacttgtcgttcatgtggacgcacccgggcaagaagctgctgttcatg
ggcagcgagttcggccagtggcgcgagtggaaccatgaccgcgagctggactggcatctg
ctcgaagaggccgatcaccgtggcgtgcagaacctggtgcgcgatctgaaccggctgtac
agccaggagccggcgttgcacgaactggacagcgacccgcagggtttccagtggctgatc
ggcgatgaccgcgccaacagcgtgttcgcctggctgcgcaagagttcgaccgggcacccg
ctgctggtggtcgccaacttcacgccggttgtacgtgaggcgtaccgcatcggcgttccg
gtggaggccaagtggctggaggtcttcaacagcgacgcggcctgctacggcggctcgaac
accggcaacggcggcggcatgctcgccgagccggtcgagagccacggcgagaaggtatcg
ctgtcactgaccctgccgccgctcggcgtgctggtactgcggccgcaggtgtaa

DBGET integrated database retrieval system