KEGG   Pseudomonas stutzeri CCUG 29243: A458_10055Help
Entry
A458_10055        CDS       T02168                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A458_10055
Enzymes [BR:psc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     A458_10055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2189899..2191974)
Genome map
AA seq 691 aa AA seqDB search
MSDESLIRLAEAAGLSIDWVDADNREQRVEPAVLRDVLTCLGLAAETDADIEASLEILAH
KNNHGGVPPLLTCDQHAVLDLSAYFPAASRFELQAEDGGVQQGTLDNQARLPAIDTPGYY
RLTIDKYQLTVAIAPLSCPTVAEIAGADAWGLTVQLYGLRRADDGGLGDTQALEALVSNA
AAHGADALGISPVHAMFGAHIDQYSPYSPSSRLFFNVLHAAPGSILGERPLRQAIETCGL
GEELKRLERLELIDWPAVAQSRHRLLRQLFDDFSKGGNALQVDFDSFRASGGEALENHCR
FEALHTHLRDAQGHTQHWNDWPSEYRDPSSPAVVAFAREHADEVSYHAFGQWLMARGLER
AQVAARSAGMRIGLISDLAVGADGGGSQAWSRQAELLASLSVGAPPDIMNRDGQNWGISA
FSPWGLRQNGFRAYIEMLRANLAHAGGMRIDHVLGLKRLWVVPAGADPKRGVYLNFPFDD
MLRLLCLEAWRHQAVILGEDLGTIPHGLRDVLAARGILGMRVLLFEQHDGHFQTPAQYPA
QALATSTTHDIPTLTGWWHGHDIDWRIKVGQVPEPDRDAQWQAREKERAGLNRALCEYSG
KNPDVLLNAEEAVDAAICFLAHTPAPLVLVPVEDALGLEEQTNMPGIVETHPNWRRRYPG
DSATLLDSPASSRRLASFAQARRNHRGAAHR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaatccctgatccgcctggcggaagccgccgggctctccatcgactgggtc
gatgccgacaaccgcgaacaacgggtcgagccggccgtactgcgtgacgtactgacctgc
ctcgggctggcggcggaaaccgatgcagatatcgaagccagcctcgaaattctcgcgcac
aagaacaaccacggcggcgtgccgccgctgctgacctgcgatcagcacgctgtactggac
ctttccgcctactttccggcggccagtcgtttcgagttgcaggcagaagatggtggcgtt
cagcagggcacgctcgacaaccaggcgcgcctgcccgccatcgacacgcccggctactac
cggctgaccatcgacaagtatcagctgaccgtggctatcgccccgctctcctgccccaca
gtcgccgagatcgccggggcggacgcctggggcctgacggtgcagctatacgggctgcgc
cgcgcggacgatggtggcctgggcgacacccaggcactggaggcgctggtcagcaacgcc
gctgcccacggagccgatgcgcttggaatcagtccagtgcacgccatgttcggcgcgcat
atcgatcagtacagcccttactcaccgtcgagccggctgttcttcaacgtgctgcacgcc
gcgccgggttcgatccttggtgagcggccgttgcgccaagcgatcgagacttgcgggtta
ggtgaggaattgaaacggctcgagcgcctggagctgatcgactggccggccgtggcgcaa
tcgcggcatcgcctgttgcggcagctgttcgacgacttcagcaagggcggcaacgccctg
caggtggatttcgacagcttccgcgcgagcggtggcgaggcgttggaaaaccactgccgc
ttcgaagccctgcacactcatctgcgggacgcacagggccacacgcagcactggaacgac
tggccaagcgaataccgcgatccctccagcccggccgttgtggcctttgcccgcgaacat
gccgatgaggtgagttaccacgcctttggccagtggttgatggcccgcggcctggaacgt
gcccaggtcgccgcgcgcagcgccggtatgcgcatcgggttgatttccgacctcgccgtt
ggcgccgatggcggcggcagtcaggcctggagccgccaggccgagctgttggcatcgctg
agtgttggcgcgccgccggacatcatgaatcgcgacggccagaactggggcatttccgct
ttctcgccctggggcctgcggcagaacggctttcgcgcctatatcgaaatgctgcgggcc
aacctcgcccacgccggcggcatgcgtatcgaccacgtgcttggcctgaagcgtctctgg
gtcgtgcccgccggtgccgacccgaagcgcggcgtgtacctcaacttccccttcgacgac
atgctgcgcctgctctgcctcgaggcctggcgccaccaggcggtgatcctcggcgaagac
ctcggcaccattccccacggcctgcgtgacgtactcgcggcacggggaatcctcggcatg
cgggtgctgctgttcgaacagcacgacggccatttccagacgcctgcccagtacccggcg
caggcgctggcaaccagtaccacccacgatatcccgaccctgacgggctggtggcacggt
cacgatatcgactggcgcatcaaggtcggccaggtgcccgaaccggaccgtgatgcccag
tggcaagcgcgtgagaaagaacgcgcagggctgaatcgcgcattgtgcgagtacagcggc
aagaacccggacgtgctgctgaacgccgaggaggcggtcgatgccgccatctgcttcctg
gcgcacacccccgcgccgctggtactggttccggtggaagatgcgctcggtctggaagaa
cagaccaacatgcccggaatcgtcgaaacccatcccaactggcgtcgccggtatcccggc
gacagtgcaacattgctcgacagcccggccagtagccgtcggctggcgtcctttgcgcag
gcccgtcgtaaccatcgtggagctgcgcatcgatga

DBGET integrated database retrieval system